(data stored in ACNUC9543 zone)

EMBL: AL844507.PE312

AL844507.PE312       Location/Qualifiers
FT   CDS             join(1392168..1392299,1392407..1393131,1393467..1393491)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0832200.2"
FT                   /product="Plasmodium exported protein (PHISTa-like),
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0832200.2"
FT                   /db_xref="GOA:A0A146M1Y0"
FT                   /db_xref="InterPro:IPR006526"
FT                   /db_xref="InterPro:IPR019111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A146M1Y0"
FT                   /protein_id="CZT62764.1"
FT                   /translation="MKFHCVEYYSEENHIQNTTNVRLIRRKFLNLLSITGILLVVVLNN
FT                   IIICDKSETNDAGVFNIYRRNLSETESVEHSGLSNTSEDVELENGLEENNNNNNISCDL
FT                   EGSNSEDEVKYNDVTTKRKCDNINYNDLSKQLTLEELHSVLDDLEKSTTKEDLYNIWNQ
FT                   VLGIAKDGFDGMLTELSYYVEEYLHEYEYERYHYFGGRKPVSMKNVRETWYKSMHDIGE
FT                   ALSSTDVKNTLDFYSFVKSGASIDEMKNFIYEFIKYYDTLKNDLFNTHKKIFTEWMKEL
FT                   QGLEKKKTSKNI"
     MKFHCVEYYS EENHIQNTTN VRLIRRKFLN LLSITGILLV VVLNNIIICD KSETNDAGVF        60
     NIYRRNLSET ESVEHSGLSN TSEDVELENG LEENNNNNNI SCDLEGSNSE DEVKYNDVTT       120
     KRKCDNINYN DLSKQLTLEE LHSVLDDLEK STTKEDLYNI WNQVLGIAKD GFDGMLTELS       180
     YYVEEYLHEY EYERYHYFGG RKPVSMKNVR ETWYKSMHDI GEALSSTDVK NTLDFYSFVK       240
     SGASIDEMKN FIYEFIKYYD TLKNDLFNTH KKIFTEWMKE LQGLEKKKTS KNI              293
//

If you have problems or comments...

PBIL Back to PBIL home page