(data stored in ACNUC9543 zone)

EMBL: AL844507.PE315

AL844507.PE315       Location/Qualifiers
FT   CDS             join(1397014..1397172,1397265..1397885)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0832300"
FT                   /product="Plasmodium exported protein (PHISTa-like),
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0832300"
FT                   /db_xref="GOA:A0A143ZZX7"
FT                   /db_xref="InterPro:IPR006526"
FT                   /db_xref="InterPro:IPR019111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZZX7"
FT                   /protein_id="CZT62766.1"
FT                   /translation="MEIFYNKNLKTYKYNLYSTDINVKRMKCGITCRSFIFMSLSLCVI
FT                   SLFYISLLNIHEGNIVPSTKNIEIISRNLCEIENGNNEKRQNIMNRLDQTNESSKNSNN
FT                   NKQITLENKPYNDMSKNLTEKELYDILNSLEECPPKEDLINIWHHALRAGKGFDNVVNE
FT                   LKALIQKYLDNDFYNTCCCTKKELVYRSIWEKNCFEFYTDVAYELVKYSNGFFELINGK
FT                   HTLDDILEYIYSFLEQFKILKKELYEKYKKILLKKMN"
     MEIFYNKNLK TYKYNLYSTD INVKRMKCGI TCRSFIFMSL SLCVISLFYI SLLNIHEGNI        60
     VPSTKNIEII SRNLCEIENG NNEKRQNIMN RLDQTNESSK NSNNNKQITL ENKPYNDMSK       120
     NLTEKELYDI LNSLEECPPK EDLINIWHHA LRAGKGFDNV VNELKALIQK YLDNDFYNTC       180
     CCTKKELVYR SIWEKNCFEF YTDVAYELVK YSNGFFELIN GKHTLDDILE YIYSFLEQFK       240
     ILKKELYEKY KKILLKKMN                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page