(data stored in ACNUC9543 zone)

EMBL: AL844507.PE32

AL844507.PE32        Location/Qualifiers
FT   CDS             join(208451..208502,208762..208878,208973..209038,
FT                   209150..209218,209296..209449,209549..209742,
FT                   209846..210291)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0803300"
FT                   /product="mitogen-activated protein kinase organizer 1,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0803300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.145:mRNA"
FT                   /db_xref="GOA:Q8IAN3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAN3"
FT                   /protein_id="CAD51330.1"
FT                   /translation="MNLNVNIETVGKLSEHKACITKIIFSDDENYILSSSLDNKVCLWN
FT                   VNTHLHINTYKDVHKKGINDIALFRDNTKFFSAGNDLYVYLWDTLSNKILNRINVNDKI
FT                   NVIRLSTNEKLLFCSKNNAVNIYDFRERDFKKKNNPLQIFNEAKDWISDFIVDDFEVYT
FT                   CSIDNILRIYDLRMGKLMSYDMKSSILSIDITNDKNYFCVNLIDNTIKLVEKNSGTVLG
FT                   LYKGDINNKHKRNIKLDTKNKYIFSCSHKNEIVVYDIVRSNTINNTIFYENLEYEEDLD
FT                   IYKNTYFQLNIGKPTYYLNVNKNILPENSYIDREKYKSILNKYKYYGKKKKDIDSSDKD
FT                   FQNINNKLVCGDIDGNIHILQLYYT"
     MNLNVNIETV GKLSEHKACI TKIIFSDDEN YILSSSLDNK VCLWNVNTHL HINTYKDVHK        60
     KGINDIALFR DNTKFFSAGN DLYVYLWDTL SNKILNRINV NDKINVIRLS TNEKLLFCSK       120
     NNAVNIYDFR ERDFKKKNNP LQIFNEAKDW ISDFIVDDFE VYTCSIDNIL RIYDLRMGKL       180
     MSYDMKSSIL SIDITNDKNY FCVNLIDNTI KLVEKNSGTV LGLYKGDINN KHKRNIKLDT       240
     KNKYIFSCSH KNEIVVYDIV RSNTINNTIF YENLEYEEDL DIYKNTYFQL NIGKPTYYLN       300
     VNKNILPENS YIDREKYKSI LNKYKYYGKK KKDIDSSDKD FQNINNKLVC GDIDGNIHIL       360
     QLYYT                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page