(data stored in ACNUC9543 zone)

EMBL: AL844507.PE328

AL844507.PE328       Location/Qualifiers
FT   CDS             complement(join(1435794..1437158,1438005..1443449))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0833500"
FT                   /product="erythrocyte membrane protein 1, PfEMP1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0833500"
FT                   /db_xref="GOA:A0A143ZZY8"
FT                   /db_xref="InterPro:IPR004258"
FT                   /db_xref="InterPro:IPR008602"
FT                   /db_xref="InterPro:IPR029210"
FT                   /db_xref="InterPro:IPR029211"
FT                   /db_xref="InterPro:IPR041480"
FT                   /db_xref="InterPro:IPR042202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZZY8"
FT                   /protein_id="CZT62778.1"
FT                   /translation="MAQGGRGGQVGGDDYSDAKHLLDSIGKKVHDEIVKKDAKTYIGEL
FT                   AGLLSQASIFGGETVAFSEPCGLIKNESQKLAALGDPCGSASEKRFSKERVDEYDKKKI
FT                   KCSNSEGACAPYRRLHVCDKNMVKMDTNNDSKAKHDLLLDVCLAAKYEGESLKTYRAQY
FT                   DEQYPSSVSTFTMCTMLARSFADIGDIVRGRDLYRGNRKKNETKTEREKLDDKLKEIFE
FT                   NIRKENNSKLKSLTDDQIREYWWTANRNDVWKAITCSADKGNTYFRATCIDLNESPSMA
FT                   RDKCRCKDKSFTKETDQVPTYFDYVPQFLRWFEEWAEDFCRKKKKYVDIVKTYCRNETK
FT                   GKYCSLNGYDCTKTKPAIGRLRMGNQCTKCFFACYPYEKWIDKKKEEFLKQKQKYEKEM
FT                   EKYTNEASGSTGGRAKRSVSTTNYDGYESKFYKILKDKYKDEGLNKFLEKLSNEDVCTK
FT                   VDDEGGKIRFEKVNSGGTARSGGTSGTSSTSGDSGTNDINNKTFYRSKYCQPCPLCGMK
FT                   RTKNGGNKWEEKSGGNCKSGKLYRPKGGKDVTPIRILKSGENHDDIEEKLNAFCQAQNG
FT                   TGGVANGSGSGTSDSQKLYQEWKCYQLEELTKVVQDGVEDEDDEDDEVYDKEVEGAGGL
FT                   CILKKKKEKSEGKSQNDPDEIQKTFHNFFYYWVAHMLKDSIHWRTKKLDKCLQNGKKKC
FT                   GKKICNGDCDCFKRWVEQKRKEWDPIKKQFSKQKGIPFGCYFTTLEGVLQLEFLNENTD
FT                   EDAENNVSAEEAKEIQHLRQMLKQAGVAIGLDALGGCGTGGDSDNEKETLMDKFLEEEE
FT                   QFAEKCIKKCQETQKQPTGDGVADTSPDPSRDTNVDPEQEEEEEEDDSEEQDATVNGPE
FT                   DGGGEATQQPQGPSEKKEEVKVCETVKTALGGNLDEACNQKYGLPQRHWGWKCIPSGSG
FT                   STATREGEGSSDGGAKDGVGVNGGVLQRARRGTPGEKTATSSDSGAICVPPRRRRLYVT
FT                   PLTRLAGGDKDTQASVSPQVVGETPQVSTPALTSPPPSDPRADVDLVKAFVESAAVETF
FT                   FLWDRYKKEWEHRNKKPQDGLLLFGESTASDHMAALSHTGGPQQQPGSVSDDPQSKLQK
FT                   SGEIPTDFLRQMFYTLGDYRDICIGGDRDIVGDTIVSNTEGGTPTKISEKIEQILSKQS
FT                   GTHPPTPPGPPQTSVEKTTRESWWNAHAPSIWKGMICALTYKDGEEGKSPQVDTTVQKE
FT                   LLDKDGKPLNPQYQYTNAKLEEKNSGAKQNRNPTAPSDNKPTTLVDFISRPPYFRYLEE
FT                   WGENFCKERKKRLKQIKVECKVDQDNDKNGKKCSGYGEDCHDNVFNNNYTTFPDFYCPD
FT                   CGKYCSSYRKWIERKGKEFIKQKNAYKEQKTNFQTQSETAKEFLQKLGSCKNNNRNENA
FT                   EDNNKIFEDNGDTFEPAKDCKPCSQFRVKSEKCNCRSSGKGNTCNDKNSIDVNDIGDGG
FT                   NSTVLEMRVSDDSKSGSGFDGLGECKEAHIFKGIRKDVWTCEKVCGYNVCKPIKVDGKE
FT                   NGENQIIIIRALFKRWLEYFLEDYNKIRKKLKPCKKNGEGSPCIKDCDKICECVTKWIE
FT                   KKRTEWTNIKKHYLEKKHEKGDDGMTSLVKNFLEDLQDRPEFQNAIKPCNDLNAFEKSC
FT                   GLHGAEISQKKEGEDYDLVLCLLKKLEEKAKKCKEDHSSGEQTEKECQEYPPLPDEEYE
FT                   NEDENEKTNIQPKFCPKQQTPPKQEDEDGCVPAEAPKEVVPEKKVPSDPPPAPAPAAPP
FT                   STPAAPKHPRGGEEKKAKPSLPNPPTVFDNPHVKTALVTSTLAWSVGIGFAAFTYFYLK
FT                   KKTKSPVDLLRVLDIHKGDYDIPTKLSPNRYIPYTSGKYRGKTYIYLEGDSGTDSGYTD
FT                   HYSDITSSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSGNNTTASGKNTTASGKTQS
FT                   GNNTTASGKNTPSDTQNDIQNDGIPSNKFSDNEWNTLKDDFISNMLQNEPNTEQNMLGY
FT                   NVDNNTHPTMSRDNMEEKPFITSIHDRDLYTGEEYNYNVNMSTNNVDIPMSDKNGNYTG
FT                   IDLINDTLSGNHNVDIYDELLKRKENELFGTNNPKRTSTYSVAKNTNSDPILNQINLFH
FT                   TWLDRHRDMCEQWDTNNKKEELLDKLKEEWENETHSGNTHPSDSNKTLNTDVSIQIHMD
FT                   DPKTTNEFTYVDSNPNQVDDTYVDTYPNNSSMDTILEDLEKYKEPYYDVQDDIYYDVND
FT                   DHDTSTVDSNNMDVPSKVQIEMDVNTKLVKEKYPIADVWDI"
     MAQGGRGGQV GGDDYSDAKH LLDSIGKKVH DEIVKKDAKT YIGELAGLLS QASIFGGETV        60
     AFSEPCGLIK NESQKLAALG DPCGSASEKR FSKERVDEYD KKKIKCSNSE GACAPYRRLH       120
     VCDKNMVKMD TNNDSKAKHD LLLDVCLAAK YEGESLKTYR AQYDEQYPSS VSTFTMCTML       180
     ARSFADIGDI VRGRDLYRGN RKKNETKTER EKLDDKLKEI FENIRKENNS KLKSLTDDQI       240
     REYWWTANRN DVWKAITCSA DKGNTYFRAT CIDLNESPSM ARDKCRCKDK SFTKETDQVP       300
     TYFDYVPQFL RWFEEWAEDF CRKKKKYVDI VKTYCRNETK GKYCSLNGYD CTKTKPAIGR       360
     LRMGNQCTKC FFACYPYEKW IDKKKEEFLK QKQKYEKEME KYTNEASGST GGRAKRSVST       420
     TNYDGYESKF YKILKDKYKD EGLNKFLEKL SNEDVCTKVD DEGGKIRFEK VNSGGTARSG       480
     GTSGTSSTSG DSGTNDINNK TFYRSKYCQP CPLCGMKRTK NGGNKWEEKS GGNCKSGKLY       540
     RPKGGKDVTP IRILKSGENH DDIEEKLNAF CQAQNGTGGV ANGSGSGTSD SQKLYQEWKC       600
     YQLEELTKVV QDGVEDEDDE DDEVYDKEVE GAGGLCILKK KKEKSEGKSQ NDPDEIQKTF       660
     HNFFYYWVAH MLKDSIHWRT KKLDKCLQNG KKKCGKKICN GDCDCFKRWV EQKRKEWDPI       720
     KKQFSKQKGI PFGCYFTTLE GVLQLEFLNE NTDEDAENNV SAEEAKEIQH LRQMLKQAGV       780
     AIGLDALGGC GTGGDSDNEK ETLMDKFLEE EEQFAEKCIK KCQETQKQPT GDGVADTSPD       840
     PSRDTNVDPE QEEEEEEDDS EEQDATVNGP EDGGGEATQQ PQGPSEKKEE VKVCETVKTA       900
     LGGNLDEACN QKYGLPQRHW GWKCIPSGSG STATREGEGS SDGGAKDGVG VNGGVLQRAR       960
     RGTPGEKTAT SSDSGAICVP PRRRRLYVTP LTRLAGGDKD TQASVSPQVV GETPQVSTPA      1020
     LTSPPPSDPR ADVDLVKAFV ESAAVETFFL WDRYKKEWEH RNKKPQDGLL LFGESTASDH      1080
     MAALSHTGGP QQQPGSVSDD PQSKLQKSGE IPTDFLRQMF YTLGDYRDIC IGGDRDIVGD      1140
     TIVSNTEGGT PTKISEKIEQ ILSKQSGTHP PTPPGPPQTS VEKTTRESWW NAHAPSIWKG      1200
     MICALTYKDG EEGKSPQVDT TVQKELLDKD GKPLNPQYQY TNAKLEEKNS GAKQNRNPTA      1260
     PSDNKPTTLV DFISRPPYFR YLEEWGENFC KERKKRLKQI KVECKVDQDN DKNGKKCSGY      1320
     GEDCHDNVFN NNYTTFPDFY CPDCGKYCSS YRKWIERKGK EFIKQKNAYK EQKTNFQTQS      1380
     ETAKEFLQKL GSCKNNNRNE NAEDNNKIFE DNGDTFEPAK DCKPCSQFRV KSEKCNCRSS      1440
     GKGNTCNDKN SIDVNDIGDG GNSTVLEMRV SDDSKSGSGF DGLGECKEAH IFKGIRKDVW      1500
     TCEKVCGYNV CKPIKVDGKE NGENQIIIIR ALFKRWLEYF LEDYNKIRKK LKPCKKNGEG      1560
     SPCIKDCDKI CECVTKWIEK KRTEWTNIKK HYLEKKHEKG DDGMTSLVKN FLEDLQDRPE      1620
     FQNAIKPCND LNAFEKSCGL HGAEISQKKE GEDYDLVLCL LKKLEEKAKK CKEDHSSGEQ      1680
     TEKECQEYPP LPDEEYENED ENEKTNIQPK FCPKQQTPPK QEDEDGCVPA EAPKEVVPEK      1740
     KVPSDPPPAP APAAPPSTPA APKHPRGGEE KKAKPSLPNP PTVFDNPHVK TALVTSTLAW      1800
     SVGIGFAAFT YFYLKKKTKS PVDLLRVLDI HKGDYDIPTK LSPNRYIPYT SGKYRGKTYI      1860
     YLEGDSGTDS GYTDHYSDIT SSSESEYEEL DINDIYVPGS PKYKTLIEVV LEPSGNNTTA      1920
     SGKNTTASGK TQSGNNTTAS GKNTPSDTQN DIQNDGIPSN KFSDNEWNTL KDDFISNMLQ      1980
     NEPNTEQNML GYNVDNNTHP TMSRDNMEEK PFITSIHDRD LYTGEEYNYN VNMSTNNVDI      2040
     PMSDKNGNYT GIDLINDTLS GNHNVDIYDE LLKRKENELF GTNNPKRTST YSVAKNTNSD      2100
     PILNQINLFH TWLDRHRDMC EQWDTNNKKE ELLDKLKEEW ENETHSGNTH PSDSNKTLNT      2160
     DVSIQIHMDD PKTTNEFTYV DSNPNQVDDT YVDTYPNNSS MDTILEDLEK YKEPYYDVQD      2220
     DIYYDVNDDH DTSTVDSNNM DVPSKVQIEM DVNTKLVKEK YPIADVWDI                  2269
//

If you have problems or comments...

PBIL Back to PBIL home page