(data stored in ACNUC9543 zone)

EMBL: AL844507.PE35

AL844507.PE35        Location/Qualifiers
FT   CDS             join(223762..224639,224779..224835,224935..225387,
FT                   225531..225567,225692..225781,225876..225977,
FT                   226093..226125,226257..226396,226525..226614,
FT                   226765..226784,226890..226954,227063..227112,
FT                   227193..227329,227470..230043,230136..230209)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0803600.1"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0803600.1"
FT                   /db_xref="GOA:A0A146M1U1"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR040147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A146M1U1"
FT                   /protein_id="CZT62743.1"
FT                   /translation="MIIVNEIRHIKNITFLMDFYVVKINNFIKVIQHLLFLEKQRDKYV
FT                   YYITRTNKNKNKNKKVKNVNTTTNSNEKNNEKNDKNNENNDKNNDNVTDDHCGHHECDD
FT                   LEGRHKIQQILYNIKNMKKKRIKKNVLLDFYTQILTIHRRDQPNLINYYVTLINKLKTF
FT                   KYNIQLKKIFIQNVIKEINKEYNSFLIDLHYMYFKVKKEVSNINNYDNNNEGHEIPSIA
FT                   FNTSHNKHIYVYKSIGHVYKNILKTLKLRLEVFLNYIYNLCNNIYKKINIYMANVFSMF
FT                   IDTQEGLFSLMSKRKEYLKEIIKIISAQDNSEHVKNRISCDTLLNTFNNNDIEEDGFEK
FT                   YNLKNNQNMNNDEYTNHYMSQKKYTFTKLNYITSFYENNYYGHENNNVRRDSNYFQNEQ
FT                   ENINESGHINNVEDNINGKKKEQEDQNKDNNNENNNNDNENNNNDNENNNNDNNNDNND
FT                   NNVVKPRMKKEVITIKNIIMFFKRFKGYFKLCRKNMYELSPSLMIKEGEVLHELVVRLL
FT                   NHYTSIININKFFYKSFKKNIYNFNLPVQENKMIYILKEIYLLLHFHITHIWITIKEHT
FT                   EELKNIKNKITQENNFFDIFISYVIKNLGTGDMTPELFEKIKNVEKKITNGKESSRSIS
FT                   LYKWRSLIKINTEIDLKHGGEVSILQILSFPYDEFFNELIEENYNEENIFKKSSLEMYK
FT                   IYSKYCYSTNRKEVKECVGVHLNRTCLYQENNFIHKVLQFLQAKKCSHICMLSIEQNNI
FT                   LTSSNILVNIFNKKNERDKQFAFNLIVHYFIREKGKDTCEIHDTDKNITQTKNQHMHDQ
FT                   VSYDNSAIPILDIQKIISEKNESEDEIKSMHSLLNDDKTKNMDDNQEHKENSILFKDDI
FT                   SNQEIKLSDEESTFEDMNIEVLNMIKKIYEEREKKKLERKRKREKKRKKKKKEKKKTEA
FT                   TLQNLQDIHNKQNVHNVQDIHNKQNTHNVQDIHNKQNIHNVQDIHNKQNTPSVQDTHNN
FT                   DSKSIMSPDFNNDTNKKRETHINNNIPNPNDGRNEDKTTILDEKRKLEESQNEEKNKCP
FT                   ILEIDDHIFEINDKDHLNYIMRSSMNTFNCALSKKILIQGKIFITMDGIYFISLFNSLF
FT                   SKNTILKIKYVDIVSVEKLTILHFLANSIKIITKYKSFVFTSFVHRNHCYNLIMDMIYE
FT                   NNNTHIIPKKGTVIIDRYHEYDTDEKNDLSDEVDNTNDINYHIKEGIHTNDKIYKGDII
FT                   NDYKNNHIIDHYLKDNEMLTDSSKIKNDFPTNIENNKTKNNITNGKCPILHVSNYTKDN
FT                   NLIYVETINKHLPLNIDTEENEILKNNNFINCTNYIDSLFINRNFKDIFLDIYSNLQNQ
FT                   YNPLLKSVLDKKPLNLSYEHIKDIKDLMYNKTFLTYTTEYNILLFNNETKLIGLPDRSN
FT                   VKEIFMFFFFKNNIIIQKIITLLSNIPLAGSFNTIVTLNIHNVMNQNTNNYYTQIDFSY
FT                   DIEFVKSTFFKNHIKNNALPRLEKSIKDLKDYTKEAILQIYQNYDNQTINNNHVNPHQQ
FT                   NNMNQKNKSQKYQSFTFKNNIHIAKTDLQHMTINELREYFKHDFKSVDHLSSYTPLMYF
FT                   LIVSITAFVIYKLLDVKYHF"
     MIIVNEIRHI KNITFLMDFY VVKINNFIKV IQHLLFLEKQ RDKYVYYITR TNKNKNKNKK        60
     VKNVNTTTNS NEKNNEKNDK NNENNDKNND NVTDDHCGHH ECDDLEGRHK IQQILYNIKN       120
     MKKKRIKKNV LLDFYTQILT IHRRDQPNLI NYYVTLINKL KTFKYNIQLK KIFIQNVIKE       180
     INKEYNSFLI DLHYMYFKVK KEVSNINNYD NNNEGHEIPS IAFNTSHNKH IYVYKSIGHV       240
     YKNILKTLKL RLEVFLNYIY NLCNNIYKKI NIYMANVFSM FIDTQEGLFS LMSKRKEYLK       300
     EIIKIISAQD NSEHVKNRIS CDTLLNTFNN NDIEEDGFEK YNLKNNQNMN NDEYTNHYMS       360
     QKKYTFTKLN YITSFYENNY YGHENNNVRR DSNYFQNEQE NINESGHINN VEDNINGKKK       420
     EQEDQNKDNN NENNNNDNEN NNNDNENNNN DNNNDNNDNN VVKPRMKKEV ITIKNIIMFF       480
     KRFKGYFKLC RKNMYELSPS LMIKEGEVLH ELVVRLLNHY TSIININKFF YKSFKKNIYN       540
     FNLPVQENKM IYILKEIYLL LHFHITHIWI TIKEHTEELK NIKNKITQEN NFFDIFISYV       600
     IKNLGTGDMT PELFEKIKNV EKKITNGKES SRSISLYKWR SLIKINTEID LKHGGEVSIL       660
     QILSFPYDEF FNELIEENYN EENIFKKSSL EMYKIYSKYC YSTNRKEVKE CVGVHLNRTC       720
     LYQENNFIHK VLQFLQAKKC SHICMLSIEQ NNILTSSNIL VNIFNKKNER DKQFAFNLIV       780
     HYFIREKGKD TCEIHDTDKN ITQTKNQHMH DQVSYDNSAI PILDIQKIIS EKNESEDEIK       840
     SMHSLLNDDK TKNMDDNQEH KENSILFKDD ISNQEIKLSD EESTFEDMNI EVLNMIKKIY       900
     EEREKKKLER KRKREKKRKK KKKEKKKTEA TLQNLQDIHN KQNVHNVQDI HNKQNTHNVQ       960
     DIHNKQNIHN VQDIHNKQNT PSVQDTHNND SKSIMSPDFN NDTNKKRETH INNNIPNPND      1020
     GRNEDKTTIL DEKRKLEESQ NEEKNKCPIL EIDDHIFEIN DKDHLNYIMR SSMNTFNCAL      1080
     SKKILIQGKI FITMDGIYFI SLFNSLFSKN TILKIKYVDI VSVEKLTILH FLANSIKIIT      1140
     KYKSFVFTSF VHRNHCYNLI MDMIYENNNT HIIPKKGTVI IDRYHEYDTD EKNDLSDEVD      1200
     NTNDINYHIK EGIHTNDKIY KGDIINDYKN NHIIDHYLKD NEMLTDSSKI KNDFPTNIEN      1260
     NKTKNNITNG KCPILHVSNY TKDNNLIYVE TINKHLPLNI DTEENEILKN NNFINCTNYI      1320
     DSLFINRNFK DIFLDIYSNL QNQYNPLLKS VLDKKPLNLS YEHIKDIKDL MYNKTFLTYT      1380
     TEYNILLFNN ETKLIGLPDR SNVKEIFMFF FFKNNIIIQK IITLLSNIPL AGSFNTIVTL      1440
     NIHNVMNQNT NNYYTQIDFS YDIEFVKSTF FKNHIKNNAL PRLEKSIKDL KDYTKEAILQ      1500
     IYQNYDNQTI NNNHVNPHQQ NNMNQKNKSQ KYQSFTFKNN IHIAKTDLQH MTINELREYF      1560
     KHDFKSVDHL SSYTPLMYFL IVSITAFVIY KLLDVKYHF                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page