(data stored in ACNUC9543 zone)

EMBL: AL844507.PE37

AL844507.PE37        Location/Qualifiers
FT   CDS             complement(join(233467..234179,234342..234426))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0803800"
FT                   /product="proteasome subunit beta type-4"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0803800"
FT                   /db_xref="GOA:Q7K6A9"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR016295"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="PDB:5FMG"
FT                   /db_xref="UniProtKB/TrEMBL:Q7K6A9"
FT                   /protein_id="CAD51325.1"
FT                   /translation="MTLGPVVTGTSVIAIKYKHGIMIAADRKASYGSYAKFQNVERIFK
FT                   INNKTVMGFSGELADAQYLHELLTRKNINNLSEKKRKEDMYTPQHYHSYVSRVFYVRKN
FT                   RIDPLFNNIIIAGINSQKYDNNDDNVLLYTNKNNDDEQNEYKNNEEYKEIHKDDLYIGF
FT                   VDMHGTNFCDDYITTGYARYFALTLLRDHYKDNMTEEEARILINECLRILYFRDATSSN
FT                   FIQIVKVTSKGVEYEEPYILPCVLNSADYVYPSTLLPPAGCMW"
     MTLGPVVTGT SVIAIKYKHG IMIAADRKAS YGSYAKFQNV ERIFKINNKT VMGFSGELAD        60
     AQYLHELLTR KNINNLSEKK RKEDMYTPQH YHSYVSRVFY VRKNRIDPLF NNIIIAGINS       120
     QKYDNNDDNV LLYTNKNNDD EQNEYKNNEE YKEIHKDDLY IGFVDMHGTN FCDDYITTGY       180
     ARYFALTLLR DHYKDNMTEE EARILINECL RILYFRDATS SNFIQIVKVT SKGVEYEEPY       240
     ILPCVLNSAD YVYPSTLLPP AGCMW                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page