(data stored in ACNUC9543 zone)

EMBL: AL844507.PE39

AL844507.PE39        Location/Qualifiers
FT   CDS             242103..244775
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0804300"
FT                   /product="zinc finger protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0804300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.141:mRNA"
FT                   /db_xref="GOA:Q8IAN9"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAN9"
FT                   /protein_id="CAD51323.1"
FT                   /translation="MNYLKDPYVVNNEHEINRNNCYLHEEEKKYINVEEKHFINVQQKD
FT                   FINVQQKDFINVKQNEFINVKQNEFINVEQKDFLNVEQKDFLNVEECIPQNNNLSSRKR
FT                   YINYNNISGPYNIHNNFYNHYKKQKKHYNATNFYAKNNLFSHNQQNGVYHMNINNRNVS
FT                   NNGCVMNKITKSFEKKKQKKSSSHGLYKHVNDTTTCLLDNQIYEHNNLYLNTDSFVDCE
FT                   QNKNDSKKHRNNKHVRDSEYVYNSEFAQNSDQRVSSLSCENKPINNPVKRSFILNDKNV
FT                   GSGYFLNETIVENMNYHNNKYEDNKNHVSNQFINDTYCNNNNNNNIYVKNETCYNFLPN
FT                   NDTERNEMNSTHAIEREEDIIKHITKYNEEGKRRKKKRNMDILSKDEILKDAVEYFKKC
FT                   SSRNIDNVNYDSSYEEDMKIKNLHHKENMCYVCKEKEHIYKCPYCEICTCSLVCSKNHK
FT                   KMFKCTQKLKKNLKIKNVSKGNFDESILYKDFLYLQNIETIIRGNYKYIKVKNYETTNI
FT                   WLLHNKMLIKLLKKRKIILLKAPIFTKIHKENKTFIYNHILFWTIKITFVNLNIRILHH
FT                   EINENLTFLQIIQYLCSKIEKLQTKIFIYLQNVKSIYVSLNNEQPNKARKNLNHHQNKN
FT                   TNNDNNNACDMKKYCSVQQVLRKSLCGKSFYEYPHFDIEILYEDNKPIVNPLYELEHKK
FT                   EEDNQQNCQQEGSIGNTIRMREGGEDNKEGDEDNKEGDEDNKEGDEHNKEDDKDNKEND
FT                   ENNDEGDENNDEGDEDNDEDDEDNDEDDEDNDEGDEGNDKGDEYNDEGDENNDEGDEDN
FT                   DEDDEDNDEDDEDNDEGDEGNDKGDEYNDEGDEYNDEGDEYNDEGDEYNDEGDEYNDEG
FT                   DEYNDEDDNDMNNNDKNNM"
     MNYLKDPYVV NNEHEINRNN CYLHEEEKKY INVEEKHFIN VQQKDFINVQ QKDFINVKQN        60
     EFINVKQNEF INVEQKDFLN VEQKDFLNVE ECIPQNNNLS SRKRYINYNN ISGPYNIHNN       120
     FYNHYKKQKK HYNATNFYAK NNLFSHNQQN GVYHMNINNR NVSNNGCVMN KITKSFEKKK       180
     QKKSSSHGLY KHVNDTTTCL LDNQIYEHNN LYLNTDSFVD CEQNKNDSKK HRNNKHVRDS       240
     EYVYNSEFAQ NSDQRVSSLS CENKPINNPV KRSFILNDKN VGSGYFLNET IVENMNYHNN       300
     KYEDNKNHVS NQFINDTYCN NNNNNNIYVK NETCYNFLPN NDTERNEMNS THAIEREEDI       360
     IKHITKYNEE GKRRKKKRNM DILSKDEILK DAVEYFKKCS SRNIDNVNYD SSYEEDMKIK       420
     NLHHKENMCY VCKEKEHIYK CPYCEICTCS LVCSKNHKKM FKCTQKLKKN LKIKNVSKGN       480
     FDESILYKDF LYLQNIETII RGNYKYIKVK NYETTNIWLL HNKMLIKLLK KRKIILLKAP       540
     IFTKIHKENK TFIYNHILFW TIKITFVNLN IRILHHEINE NLTFLQIIQY LCSKIEKLQT       600
     KIFIYLQNVK SIYVSLNNEQ PNKARKNLNH HQNKNTNNDN NNACDMKKYC SVQQVLRKSL       660
     CGKSFYEYPH FDIEILYEDN KPIVNPLYEL EHKKEEDNQQ NCQQEGSIGN TIRMREGGED       720
     NKEGDEDNKE GDEDNKEGDE HNKEDDKDNK ENDENNDEGD ENNDEGDEDN DEDDEDNDED       780
     DEDNDEGDEG NDKGDEYNDE GDENNDEGDE DNDEDDEDND EDDEDNDEGD EGNDKGDEYN       840
     DEGDEYNDEG DEYNDEGDEY NDEGDEYNDE GDEYNDEDDN DMNNNDKNNM                  890
//

If you have problems or comments...

PBIL Back to PBIL home page