(data stored in ACNUC9543 zone)

EMBL: AL844507.PE41

AL844507.PE41        Location/Qualifiers
FT   CDS             join(250083..267539,267790..268437)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0804500"
FT                   /product="conserved Plasmodium membrane protein, unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0804500"
FT                   /db_xref="GOA:A0A143ZZV5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZZV5"
FT                   /protein_id="CZT62744.1"
FT                   /translation="MDRSCKECNVRISRDSAHDEYDNKDLVHIYRKPMINKSVFLKRSE
FT                   KKYHPINKHVINSYNIFPYGGIYYHDIIIKDVLKFFYKNNDKRNSYSNYLLHPERESSN
FT                   YVYLGAGIMREEQNKKNKEKNKMVFIFFINEILLKRLRRNNLRKRRIRRVGKGEQNENI
FT                   NIINSNNNNNNNINCSNNDQMYCPSRQGDIKEEDGNKETKKNIINNKCNNNNNNNNNNN
FT                   NDESCFVRNVEENVKEVNKKNVLLSSSSSLNRNKNYVKEYKKKRSNIKRLQDIDNILNE
FT                   QSNNKHTFIRTKSSLFYEDIKTKEGGTCTDVNRNKKNTSMNSFFSDWKNIEENNTNIIN
FT                   DIINEEIYVNKSTTLDSLYNKESSNDRERLCDKRSGGKKRDHYEYEYYDDYGDDYVDDY
FT                   GDDCSDDYGDDYGDDYGDDYGDDYGDDYGDDYSDDYIDDYIDDYSDDYSDDYINDYGDD
FT                   YIDNHCNNHCKHLEELHGQPNKVYKKGTYGPSEKQNVYTDKNNIFLLNILHHQNNVYSV
FT                   KWKESSYEEFSILVSICYDGYMYIWKEHMNCNNKFTFISICRIYILYFENLIQNIKWYW
FT                   IKKNEENEENYNFLFNNKNINLSKNEYLIVYGSKNDLLDNKDNYYNNFICTQKNKMKNC
FT                   IYYNEFKSNHNNDDHNGDHNNDLNNDHNNDHNNNLYYSDIKDFMVFSIYGIFNIYDNNI
FT                   HIKNILNHENIPLHINFNHILDAKLEYNLMNTSLISVYTDDTYSPVNEYNIKYGKWKIK
FT                   KIIDHSIIINNSKSPQHLNYINTQNNNIINHQCYDKTFSPLSYYIQNNKHLNNKQNDFI
FT                   LFEKLFNTINNLMPPFSIKISTYNKDFYKIFIKPSDIWIKKKKSISIRYFVDYKNLLLQ
FT                   PSQKKNYKHHKQNNYHHYHHYHHYHRYHNFNNIKKNNNMFKYKHMQYDLQFNIYHNILV
FT                   ILNKINNKMYLYDVVGSLKKKNINNNNKKNKKKKKNYYSFNQDTNIHTQPLENSNTYEN
FT                   NMNKNNIYEYHMNSDINSNHVNANHLLNKNVTQNIQSTQLSSNINTNYVPHRNNNLQMY
FT                   EQNNLNNQTIYNTQRNNNFVLSSNQLDYINEHNNNDACGDTSLYKTNSCGKHNIKCNKR
FT                   LQKNTQFYSLICCLNSIYIDNYYILKYKGYDFLNNKTHFIYSYVYKFSTFYDNVKKNKN
FT                   LYVSTSEILEKKHLIPLVYKCKMIESFDSFFLLLCIDKNKEHVFALKSEKMNIVNNIKM
FT                   ICIFDDYSSYIQPFNVNKKNDTLYNKNVNTKIKLDNNIYINKVKSDILLIEGHKEINII
FT                   DYVIDDFYIYNKNIEHNLLLIIKYVYTVHKNNNLHNKKKKKEIYLLTISTIDICKDSFI
FT                   YLNLKLKNMFTFFNPIKNNKFLFSYYTLSFQNIILFVTNHNLILKDKGNYNFNEECAYD
FT                   DSDEDDEYEDGHGEYKERHGEYKERHGEYKERHGEYKERHGEYKESHGEYKERHGEYKE
FT                   RHGEYKDRHGEYKDDKTQNCTSNYMSIYNIANNYNDNKDYSREKVFEKNDHSFFFKRQK
FT                   IYSKKDSMSNEECVVFINNSDDEKYEDTNNMHNVNKIKTNNSKNVTINNNNINSNSNKF
FT                   SNFISRAFNTSHTFSDKHNSNSKESNKNKQTNSGCTTRKNKNAVNLYFLCTKKGSVVHF
FT                   MQIQNILKLVNILLYNSYILFITNKNIHILNLNNLYNNLIYQEKVNHFKLNKSYSNVNE
FT                   LTHTINQENVLSKSEKQSNWLVTFSFPDLLRGKTTQIYMTSAGKKNVHFIVISFMLMDQ
FT                   GVYDMSDKMNRNELYGNEEIVRKYNKNYGNDFCYKSVVLYNNACDDEEWNILKYENNNI
FT                   FIYSKNSLFLYGNKLLILKDVRRREDQCVCVGNYNDDNMGEKQSSEIDNKSKHYLASRK
FT                   EKRIEEYYLKKTENISLNNKIKFYEINLLKKFKKHILNLYKLDVLNGDDYKEEGILKEK
FT                   GKNKETVIKSVNNMNKIYSVNNFHYNNTKLVFYHPILLLNYIKMGLFSHVHLSLKLLLH
FT                   ILLNIFYKEKTTYNIKKNCALRFVMENKKLEMTHYNYQDICCSVQKSQFLYDLNFIHGE
FT                   IYNLYKNKKESLYSSNNLPRDDKNYLTKEKLEQKDQEKENKDKSIYLFENESISLDDFN
FT                   LNSDSDDDNNDNNKEEAEKKNNKMNNNNNNNNNNNKNKDYDDDDDDDNSLLSDDEDKPS
FT                   ELSNPDNNYNNDEKKLKEYLKYSNVINYELSIEEIKMLQILLLHINVPRLNNFFQLILY
FT                   CMLNAFYYNMDYVCEEAQKYINKENKENSDDDNYNNEIYSDNDHHHNDDNQNDDEEKKG
FT                   YKICHCEHFNFNLQKEKITYENIHIYEYINNINNNDLVNNINYEDKNLLCINLNKNNLS
FT                   SCLLFFFRFYINCLMLLNINIDIDYEYVHLFHFISIEDVGKEIYKYAENILTHYTHYFD
FT                   ISVNEDDLFSINLFNKKTYCDNIKNDHIKYDNIKYDNIKRDDIKKDNIKWDNKVKIIPL
FT                   IKKKKHNINSFCATSPLNNKKDNTYDTLDELSNKKENNNNNSNYYDFEGYIKNNKIIEL
FT                   NNIFLEKIHKSDIILEYVLKYNLFIFFKRLQLFYFMNTKKDLLFIYDILLNRTIKKINT
FT                   INIEDKEKQNELNECMDFLALLYIAKNEKSKLMLFYKIKKQNKIYDFLSNNFKTERWLK
FT                   ALMNNAYKLMQIKRYYLATAFFILSGDIKDAIDVIHQYLQDAQLSIFLIRLINISYNVS
FT                   THENKKNDNINGDKINGDKISGDKINGDKISGDKINGDKINGDKINGDKINGDKINGDK
FT                   INGDNINGDQINGDKINSNNFMETSSTPQGFISNNISPISSNLAVFSNSPINSNSVHEK
FT                   KNDDEQNDTTHIQNKKECLSSSLITHSVSYINKDSVDVLNIHMKREETNMLSTINRDLG
FT                   NDMVKDKKESTYDERGETPELVQTNENFIYKYLNYILNEKIKDDVDNNHMSDTNLLNNK
FT                   EKYNYIYKRGDSNKNMSFYILKHIMLGDLEKVYYTCEKKKVTNFFYLLLKNVIKEILIS
FT                   NNIIKIPIQNNNNNNNHDNNNIGYLVGGGGKNFIDEEVNIVKCNEKYKDVHNINMNNVK
FT                   IYKSELYLYSINLFDAGLYNLSFVFYFLFFYYIKAYNLNKIYDRYKYFFMLYSEMYLEK
FT                   YLFSIPFLFSSIFTFPHILKYSKRVDVKEGIDQIKKNNSNNNNNNNNNMMMMVMTDKNK
FT                   YDTYKYNTPFFKTYDLLNKDNIIIINNNEERGERIDFVYSLNVFSRIINGLFILIRNND
FT                   DTNNMVNKVTYNNNNNNNNNYYYNSIYDHLMDILFIKRNEGHDDNYKNYINEEYKNNSD
FT                   LLDIHEFNKYNKNQEIIINWKKEINCIFNLLNKLTYLKIRDISENKINLNYFLINLLSK
FT                   IWGISRHKKKMFLSKKNKNMNTKKRNINENNIIHHEEDINVIRNVNNKDNVCIRTNKIN
FT                   NKFHHQNGIYDDNNNNNNIMISFQPLFDVILCDNNNNNNKKKKKKIKIYYYYTALNKYK
FT                   IILTHLFFYFFHLYMKNYNEEYIMFLLINYIISIQFLYITDVVNILLNFFQQKKKKKKS
FT                   LVALHIAFLQIILFRLTMSNFFVYYNEKRKKETCMDMIQYFDKKKIINNSNTYKNNNIN
FT                   TINNDNNYYYVGNINDEQGKLSIVKPSIYLEKDINIYNIKEVVNRKYFTYYIHLIDLFL
FT                   CYISILILCFTILKKYYNFFDYNGVYIDKSNSMKKKIKGNRKKKKNLKKLYYVLYVFLK
FT                   KIKKINWNIESVYKRNVSVTSAFSKFIESYYVIKVGKKERKQKKKIIKKKNYKKRNNND
FT                   DNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSSTCNNDSHFYMSNNPCDGKNTNFDE
FT                   DKKQIKLKHKTSISTKKKLIKNSINNICAQISIKSCEYLQKKKRPSDYMFEKFCIINIF
FT                   LSVFEFLIGNFHIFAYKSNVFIPNTMNIKKGDLRKEKVHNKSSVQNNNKYKTNIVLDDV
FT                   HTNMLIDDIHTNILKDKLQINHINNQNTHFFYYHIYTLLLCIDNLSIHMNNFIYCKMKM
FT                   LLYNSAYNIKNTLLTFLSFPFFFSKLKVKPNYIKCEHFIDSHISSFFHKHLYLIWKLQN
FT                   CTYRSFLLFFNEEFYNFNDYINDKLLSYRNLINKININQRNDNFCKHSHEDEHNIYDKK
FT                   KNGNNNHNNNDHNDHNDHNDHNKKKYDNNYDNKNIIDPSYNYNNNNENHSLQSNKISDN
FT                   MKDPGNTYDNKNRKYKDDRNHVKEKDKRKKKKEKEKNIIKEESPLFNNTVMNNNSGNNN
FT                   YNNIHHCDNTSDAYINSYKNEYKKFYDLYNRGFKLTEKDYILIPNVCIEKTNIACNHSN
FT                   FLFKKSKSYEKFASFTSKINFLKKFKKNYVKANFIKCKEKKKKKKKKKNVPQNNYKNHQ
FT                   EQNYNSYYSIDYDNLFKMSSYTSSVLSNPNSDDEYIENDDHYHDHNVKVERTDIYNYDG
FT                   YYNNIYKGNNNNNNNDDDHNNDNYNDNYNDNIFHCYEKKKKNNRHTSIFRQNNKKLPHV
FT                   IPLSLLFYNFNEKYFMEKNKVDQSNSTILYIHKKNKIKKICILDHLKKLNKKCKFINYI
FT                   SYNDIEYDNKYISKKKKKKIILNEGYNNEINKKSKNHSSMINTSNKTIVSSDIHNTSNI
FT                   LPQFIFQNRESQADAHIEPKNENIQNGKPHILQLQKRSLGSDSIYDENGNINEQNFNVS
FT                   NTIEEEGEGEGEEEEEGEGNNQNRNDHNNDARLNHEQNDLVKEEKENMNKIMIHNNNKN
FT                   NHNKKNQKVFLDINMNKLLYIYKCMHIQCMHNLTPLCSFLNTFVPNDYSITNFFHNTYN
FT                   NYFVNNIFFHNFFYTYDNSLTLLLNSNNMNSLHYHNDIISHVDYGNEHDVYKNNSYAPG
FT                   GFKSAGADENLRKKSSKGRNKNKINNHMDDNYNNGANIYNNGDNIYNNGDNIYNNGDNI
FT                   YNNFDLSSGYEKKEHFNNLHTDKEKYEIEKSKNIKSVGINNKYNNNMNAYDEIKNNLII
FT                   SKTAEKYMEMLLLLLYNNMRLYDKDKINDTNNTKKNEFRYFFEYIDKNINSCIRKKYNF
FT                   INQLSDEQRNISFFKTGGIISHPFLPFFALIHINNNEKNMNEQIIDKEKFQIKFCRFTD
FT                   NYDDISYKYGSITSMTWNDSGNLLMVSDDEGYLYIYNIFLGNFIWTKTKERALYKKNLT
FT                   SSSKNASKETKNKDIPNVTNDNTCSVKCVSDYRQEEKERGQHYKGRKDDQETYEEEYDE
FT                   ESEQDDYYDDDYYDDDYYDDDYYDDDYYDDNSYNDNSYDDNSYDDNSYDDEKKMNKKSL
FT                   PYNKTQKRYQRKDKNNKLRNFFKENILKKKKKYMMEKETKDMIYMKNMRKLHIMRIKRR
FT                   RKKLNKKKGYIIKEAMCVIKLHDQIIDIKYLNDNNFYIISIGKGVNKKCLNNNTVFINS
FT                   YFMKSQENHMNKEKTETPRNCNIYKENMMNMKSFMDDNKYSNNMMSSPYIQYVNNLTIS
FT                   NNNNNNNDSNNNTVYDKKKQKDDQEENELQKINDTNTNIYEVQDKTQNTHHIIPTNLNN
FT                   NNNNNKENITIQNDEKIHQVKTSHVHNNSTNVIQGINEKNAILDNFNITKKKNKMYTTK
FT                   NNDTSNNNNNNNYYNNNNHVDTFLNQHVLKSKKSYFKSRFFYFDSSNIIPMKFFKKNKK
FT                   LQEQNDILDNICICIWDMCSILTNEEKQYLKNKNVEMNTNENVNNKTESKKMKKKKSVI
FT                   LHPSLVCVISNLSKYYINNENIKNMNSYNNNNNNNINLYNNNNNNNNNNCITSFSVWTS
FT                   TFTNYMYKSVCPFEKQNSMPLNEVGKNSTELSEPPKKKSIFWSLFKNKIHSDHFSQDAY
FT                   IFYGDQLGYIHLIHLQLHREIYCFKPFDFPIFKIFITTNMCTKLLILAEDRLKIYEILP
FT                   GLQVVFIKEIEIKHDVSPKKCICEEKIHELKERRKKEEHENEGISIFNLSYFLSSNYHK
FT                   KQSNTRSDEKMNSSYNYSYNRMPSDNNKSNNLLNGSAQNVNTNDSKKTVQLYSFQKNDK
FT                   KKEKNTNSSFNSISHLKSPSENSEEMDIHSDKEGYQSVIIGGINFGYLGFNFSKFMNNK
FT                   KKITIIDAYLLSTTHLVTISNNGTIALIKI"
     MDRSCKECNV RISRDSAHDE YDNKDLVHIY RKPMINKSVF LKRSEKKYHP INKHVINSYN        60
     IFPYGGIYYH DIIIKDVLKF FYKNNDKRNS YSNYLLHPER ESSNYVYLGA GIMREEQNKK       120
     NKEKNKMVFI FFINEILLKR LRRNNLRKRR IRRVGKGEQN ENINIINSNN NNNNNINCSN       180
     NDQMYCPSRQ GDIKEEDGNK ETKKNIINNK CNNNNNNNNN NNNDESCFVR NVEENVKEVN       240
     KKNVLLSSSS SLNRNKNYVK EYKKKRSNIK RLQDIDNILN EQSNNKHTFI RTKSSLFYED       300
     IKTKEGGTCT DVNRNKKNTS MNSFFSDWKN IEENNTNIIN DIINEEIYVN KSTTLDSLYN       360
     KESSNDRERL CDKRSGGKKR DHYEYEYYDD YGDDYVDDYG DDCSDDYGDD YGDDYGDDYG       420
     DDYGDDYGDD YSDDYIDDYI DDYSDDYSDD YINDYGDDYI DNHCNNHCKH LEELHGQPNK       480
     VYKKGTYGPS EKQNVYTDKN NIFLLNILHH QNNVYSVKWK ESSYEEFSIL VSICYDGYMY       540
     IWKEHMNCNN KFTFISICRI YILYFENLIQ NIKWYWIKKN EENEENYNFL FNNKNINLSK       600
     NEYLIVYGSK NDLLDNKDNY YNNFICTQKN KMKNCIYYNE FKSNHNNDDH NGDHNNDLNN       660
     DHNNDHNNNL YYSDIKDFMV FSIYGIFNIY DNNIHIKNIL NHENIPLHIN FNHILDAKLE       720
     YNLMNTSLIS VYTDDTYSPV NEYNIKYGKW KIKKIIDHSI IINNSKSPQH LNYINTQNNN       780
     IINHQCYDKT FSPLSYYIQN NKHLNNKQND FILFEKLFNT INNLMPPFSI KISTYNKDFY       840
     KIFIKPSDIW IKKKKSISIR YFVDYKNLLL QPSQKKNYKH HKQNNYHHYH HYHHYHRYHN       900
     FNNIKKNNNM FKYKHMQYDL QFNIYHNILV ILNKINNKMY LYDVVGSLKK KNINNNNKKN       960
     KKKKKNYYSF NQDTNIHTQP LENSNTYENN MNKNNIYEYH MNSDINSNHV NANHLLNKNV      1020
     TQNIQSTQLS SNINTNYVPH RNNNLQMYEQ NNLNNQTIYN TQRNNNFVLS SNQLDYINEH      1080
     NNNDACGDTS LYKTNSCGKH NIKCNKRLQK NTQFYSLICC LNSIYIDNYY ILKYKGYDFL      1140
     NNKTHFIYSY VYKFSTFYDN VKKNKNLYVS TSEILEKKHL IPLVYKCKMI ESFDSFFLLL      1200
     CIDKNKEHVF ALKSEKMNIV NNIKMICIFD DYSSYIQPFN VNKKNDTLYN KNVNTKIKLD      1260
     NNIYINKVKS DILLIEGHKE INIIDYVIDD FYIYNKNIEH NLLLIIKYVY TVHKNNNLHN      1320
     KKKKKEIYLL TISTIDICKD SFIYLNLKLK NMFTFFNPIK NNKFLFSYYT LSFQNIILFV      1380
     TNHNLILKDK GNYNFNEECA YDDSDEDDEY EDGHGEYKER HGEYKERHGE YKERHGEYKE      1440
     RHGEYKESHG EYKERHGEYK ERHGEYKDRH GEYKDDKTQN CTSNYMSIYN IANNYNDNKD      1500
     YSREKVFEKN DHSFFFKRQK IYSKKDSMSN EECVVFINNS DDEKYEDTNN MHNVNKIKTN      1560
     NSKNVTINNN NINSNSNKFS NFISRAFNTS HTFSDKHNSN SKESNKNKQT NSGCTTRKNK      1620
     NAVNLYFLCT KKGSVVHFMQ IQNILKLVNI LLYNSYILFI TNKNIHILNL NNLYNNLIYQ      1680
     EKVNHFKLNK SYSNVNELTH TINQENVLSK SEKQSNWLVT FSFPDLLRGK TTQIYMTSAG      1740
     KKNVHFIVIS FMLMDQGVYD MSDKMNRNEL YGNEEIVRKY NKNYGNDFCY KSVVLYNNAC      1800
     DDEEWNILKY ENNNIFIYSK NSLFLYGNKL LILKDVRRRE DQCVCVGNYN DDNMGEKQSS      1860
     EIDNKSKHYL ASRKEKRIEE YYLKKTENIS LNNKIKFYEI NLLKKFKKHI LNLYKLDVLN      1920
     GDDYKEEGIL KEKGKNKETV IKSVNNMNKI YSVNNFHYNN TKLVFYHPIL LLNYIKMGLF      1980
     SHVHLSLKLL LHILLNIFYK EKTTYNIKKN CALRFVMENK KLEMTHYNYQ DICCSVQKSQ      2040
     FLYDLNFIHG EIYNLYKNKK ESLYSSNNLP RDDKNYLTKE KLEQKDQEKE NKDKSIYLFE      2100
     NESISLDDFN LNSDSDDDNN DNNKEEAEKK NNKMNNNNNN NNNNNKNKDY DDDDDDDNSL      2160
     LSDDEDKPSE LSNPDNNYNN DEKKLKEYLK YSNVINYELS IEEIKMLQIL LLHINVPRLN      2220
     NFFQLILYCM LNAFYYNMDY VCEEAQKYIN KENKENSDDD NYNNEIYSDN DHHHNDDNQN      2280
     DDEEKKGYKI CHCEHFNFNL QKEKITYENI HIYEYINNIN NNDLVNNINY EDKNLLCINL      2340
     NKNNLSSCLL FFFRFYINCL MLLNINIDID YEYVHLFHFI SIEDVGKEIY KYAENILTHY      2400
     THYFDISVNE DDLFSINLFN KKTYCDNIKN DHIKYDNIKY DNIKRDDIKK DNIKWDNKVK      2460
     IIPLIKKKKH NINSFCATSP LNNKKDNTYD TLDELSNKKE NNNNNSNYYD FEGYIKNNKI      2520
     IELNNIFLEK IHKSDIILEY VLKYNLFIFF KRLQLFYFMN TKKDLLFIYD ILLNRTIKKI      2580
     NTINIEDKEK QNELNECMDF LALLYIAKNE KSKLMLFYKI KKQNKIYDFL SNNFKTERWL      2640
     KALMNNAYKL MQIKRYYLAT AFFILSGDIK DAIDVIHQYL QDAQLSIFLI RLINISYNVS      2700
     THENKKNDNI NGDKINGDKI SGDKINGDKI SGDKINGDKI NGDKINGDKI NGDKINGDKI      2760
     NGDNINGDQI NGDKINSNNF METSSTPQGF ISNNISPISS NLAVFSNSPI NSNSVHEKKN      2820
     DDEQNDTTHI QNKKECLSSS LITHSVSYIN KDSVDVLNIH MKREETNMLS TINRDLGNDM      2880
     VKDKKESTYD ERGETPELVQ TNENFIYKYL NYILNEKIKD DVDNNHMSDT NLLNNKEKYN      2940
     YIYKRGDSNK NMSFYILKHI MLGDLEKVYY TCEKKKVTNF FYLLLKNVIK EILISNNIIK      3000
     IPIQNNNNNN NHDNNNIGYL VGGGGKNFID EEVNIVKCNE KYKDVHNINM NNVKIYKSEL      3060
     YLYSINLFDA GLYNLSFVFY FLFFYYIKAY NLNKIYDRYK YFFMLYSEMY LEKYLFSIPF      3120
     LFSSIFTFPH ILKYSKRVDV KEGIDQIKKN NSNNNNNNNN NMMMMVMTDK NKYDTYKYNT      3180
     PFFKTYDLLN KDNIIIINNN EERGERIDFV YSLNVFSRII NGLFILIRNN DDTNNMVNKV      3240
     TYNNNNNNNN NYYYNSIYDH LMDILFIKRN EGHDDNYKNY INEEYKNNSD LLDIHEFNKY      3300
     NKNQEIIINW KKEINCIFNL LNKLTYLKIR DISENKINLN YFLINLLSKI WGISRHKKKM      3360
     FLSKKNKNMN TKKRNINENN IIHHEEDINV IRNVNNKDNV CIRTNKINNK FHHQNGIYDD      3420
     NNNNNNIMIS FQPLFDVILC DNNNNNNKKK KKKIKIYYYY TALNKYKIIL THLFFYFFHL      3480
     YMKNYNEEYI MFLLINYIIS IQFLYITDVV NILLNFFQQK KKKKKSLVAL HIAFLQIILF      3540
     RLTMSNFFVY YNEKRKKETC MDMIQYFDKK KIINNSNTYK NNNINTINND NNYYYVGNIN      3600
     DEQGKLSIVK PSIYLEKDIN IYNIKEVVNR KYFTYYIHLI DLFLCYISIL ILCFTILKKY      3660
     YNFFDYNGVY IDKSNSMKKK IKGNRKKKKN LKKLYYVLYV FLKKIKKINW NIESVYKRNV      3720
     SVTSAFSKFI ESYYVIKVGK KERKQKKKII KKKNYKKRNN NDDNNNNNNN NNNNNNNNNN      3780
     NNNNNNNNNN NNNNNSSTCN NDSHFYMSNN PCDGKNTNFD EDKKQIKLKH KTSISTKKKL      3840
     IKNSINNICA QISIKSCEYL QKKKRPSDYM FEKFCIINIF LSVFEFLIGN FHIFAYKSNV      3900
     FIPNTMNIKK GDLRKEKVHN KSSVQNNNKY KTNIVLDDVH TNMLIDDIHT NILKDKLQIN      3960
     HINNQNTHFF YYHIYTLLLC IDNLSIHMNN FIYCKMKMLL YNSAYNIKNT LLTFLSFPFF      4020
     FSKLKVKPNY IKCEHFIDSH ISSFFHKHLY LIWKLQNCTY RSFLLFFNEE FYNFNDYIND      4080
     KLLSYRNLIN KININQRNDN FCKHSHEDEH NIYDKKKNGN NNHNNNDHND HNDHNDHNKK      4140
     KYDNNYDNKN IIDPSYNYNN NNENHSLQSN KISDNMKDPG NTYDNKNRKY KDDRNHVKEK      4200
     DKRKKKKEKE KNIIKEESPL FNNTVMNNNS GNNNYNNIHH CDNTSDAYIN SYKNEYKKFY      4260
     DLYNRGFKLT EKDYILIPNV CIEKTNIACN HSNFLFKKSK SYEKFASFTS KINFLKKFKK      4320
     NYVKANFIKC KEKKKKKKKK KNVPQNNYKN HQEQNYNSYY SIDYDNLFKM SSYTSSVLSN      4380
     PNSDDEYIEN DDHYHDHNVK VERTDIYNYD GYYNNIYKGN NNNNNNDDDH NNDNYNDNYN      4440
     DNIFHCYEKK KKNNRHTSIF RQNNKKLPHV IPLSLLFYNF NEKYFMEKNK VDQSNSTILY      4500
     IHKKNKIKKI CILDHLKKLN KKCKFINYIS YNDIEYDNKY ISKKKKKKII LNEGYNNEIN      4560
     KKSKNHSSMI NTSNKTIVSS DIHNTSNILP QFIFQNRESQ ADAHIEPKNE NIQNGKPHIL      4620
     QLQKRSLGSD SIYDENGNIN EQNFNVSNTI EEEGEGEGEE EEEGEGNNQN RNDHNNDARL      4680
     NHEQNDLVKE EKENMNKIMI HNNNKNNHNK KNQKVFLDIN MNKLLYIYKC MHIQCMHNLT      4740
     PLCSFLNTFV PNDYSITNFF HNTYNNYFVN NIFFHNFFYT YDNSLTLLLN SNNMNSLHYH      4800
     NDIISHVDYG NEHDVYKNNS YAPGGFKSAG ADENLRKKSS KGRNKNKINN HMDDNYNNGA      4860
     NIYNNGDNIY NNGDNIYNNG DNIYNNFDLS SGYEKKEHFN NLHTDKEKYE IEKSKNIKSV      4920
     GINNKYNNNM NAYDEIKNNL IISKTAEKYM EMLLLLLYNN MRLYDKDKIN DTNNTKKNEF      4980
     RYFFEYIDKN INSCIRKKYN FINQLSDEQR NISFFKTGGI ISHPFLPFFA LIHINNNEKN      5040
     MNEQIIDKEK FQIKFCRFTD NYDDISYKYG SITSMTWNDS GNLLMVSDDE GYLYIYNIFL      5100
     GNFIWTKTKE RALYKKNLTS SSKNASKETK NKDIPNVTND NTCSVKCVSD YRQEEKERGQ      5160
     HYKGRKDDQE TYEEEYDEES EQDDYYDDDY YDDDYYDDDY YDDDYYDDNS YNDNSYDDNS      5220
     YDDNSYDDEK KMNKKSLPYN KTQKRYQRKD KNNKLRNFFK ENILKKKKKY MMEKETKDMI      5280
     YMKNMRKLHI MRIKRRRKKL NKKKGYIIKE AMCVIKLHDQ IIDIKYLNDN NFYIISIGKG      5340
     VNKKCLNNNT VFINSYFMKS QENHMNKEKT ETPRNCNIYK ENMMNMKSFM DDNKYSNNMM      5400
     SSPYIQYVNN LTISNNNNNN NDSNNNTVYD KKKQKDDQEE NELQKINDTN TNIYEVQDKT      5460
     QNTHHIIPTN LNNNNNNNKE NITIQNDEKI HQVKTSHVHN NSTNVIQGIN EKNAILDNFN      5520
     ITKKKNKMYT TKNNDTSNNN NNNNYYNNNN HVDTFLNQHV LKSKKSYFKS RFFYFDSSNI      5580
     IPMKFFKKNK KLQEQNDILD NICICIWDMC SILTNEEKQY LKNKNVEMNT NENVNNKTES      5640
     KKMKKKKSVI LHPSLVCVIS NLSKYYINNE NIKNMNSYNN NNNNNINLYN NNNNNNNNNC      5700
     ITSFSVWTST FTNYMYKSVC PFEKQNSMPL NEVGKNSTEL SEPPKKKSIF WSLFKNKIHS      5760
     DHFSQDAYIF YGDQLGYIHL IHLQLHREIY CFKPFDFPIF KIFITTNMCT KLLILAEDRL      5820
     KIYEILPGLQ VVFIKEIEIK HDVSPKKCIC EEKIHELKER RKKEEHENEG ISIFNLSYFL      5880
     SSNYHKKQSN TRSDEKMNSS YNYSYNRMPS DNNKSNNLLN GSAQNVNTND SKKTVQLYSF      5940
     QKNDKKKEKN TNSSFNSISH LKSPSENSEE MDIHSDKEGY QSVIIGGINF GYLGFNFSKF      6000
     MNNKKKITII DAYLLSTTHL VTISNNGTIA LIKI                                  6034
//

If you have problems or comments...

PBIL Back to PBIL home page