(data stored in ACNUC9543 zone)

EMBL: AL844507.PE45

AL844507.PE45        Location/Qualifiers
FT   CDS             complement(279711..281186)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0804900"
FT                   /product="GTPase-activating protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0804900"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0120:mRNA"
FT                   /db_xref="GOA:Q8IAP4"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAP4"
FT                   /protein_id="CAD51317.1"
FT                   /translation="MKKSLIEEVLEYEQDNRGYVLDTLKDKTFKIILNKNENKNCFDCG
FT                   NKNPKWLSLTYAIFICLNCSGKHRQLGTHISFVRSTGMDKFTAKQLIRICLGGNMKASE
FT                   YLKRSKDSIIDYSSHVCLKYKMYLDNLLEEILLNYSKGVKSVEFDNNNKNNNNSNNSSN
FT                   HMNSGVSNNLSMNRRQPIDLISDDIKGDEMLTSFENVQNNENDFSSTFFGFNNNSKKME
FT                   INQNNNNNNNNSNVFVPTHFIDEKVAFNNNSNKNFKAKKIDINFDNIFEQGDIINNNNN
FT                   NNNNNNVNNNYSGNPNLDNSLKLYATNQKEQQNNLEGIRGSMYDNNNSYNNMYAYNNEH
FT                   YMDNQHNAYGNRMSNPNNYLNSNGNNNNNNNGYGYGYGFNNKSSFSNNNFNVTTDSKLN
FT                   KFKDCKSIRSDQYFYDEMPRNEHVMPNVHIADSISSDQYFNKNVNNKKGVWNLDEQTVQ
FT                   NLQGLKVSAREGISNIVAAGNEVFLKAKEWFNN"
     MKKSLIEEVL EYEQDNRGYV LDTLKDKTFK IILNKNENKN CFDCGNKNPK WLSLTYAIFI        60
     CLNCSGKHRQ LGTHISFVRS TGMDKFTAKQ LIRICLGGNM KASEYLKRSK DSIIDYSSHV       120
     CLKYKMYLDN LLEEILLNYS KGVKSVEFDN NNKNNNNSNN SSNHMNSGVS NNLSMNRRQP       180
     IDLISDDIKG DEMLTSFENV QNNENDFSST FFGFNNNSKK MEINQNNNNN NNNSNVFVPT       240
     HFIDEKVAFN NNSNKNFKAK KIDINFDNIF EQGDIINNNN NNNNNNNVNN NYSGNPNLDN       300
     SLKLYATNQK EQQNNLEGIR GSMYDNNNSY NNMYAYNNEH YMDNQHNAYG NRMSNPNNYL       360
     NSNGNNNNNN NGYGYGYGFN NKSSFSNNNF NVTTDSKLNK FKDCKSIRSD QYFYDEMPRN       420
     EHVMPNVHIA DSISSDQYFN KNVNNKKGVW NLDEQTVQNL QGLKVSAREG ISNIVAAGNE       480
     VFLKAKEWFN N                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page