(data stored in ACNUC9543 zone)

EMBL: AL844507.PE47

AL844507.PE47        Location/Qualifiers
FT   CDS             286959..288620
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0805100"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0805100"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.137:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAP6"
FT                   /protein_id="CAD51315.1"
FT                   /translation="MKSLYQMNHIGHPFMYPKMDITKMNKTNNQNIPNKAHNPNNSSNM
FT                   NTTKKSYGTSLNYIKKENSSKNSIYNNYEYLDASHLEMLDLNKNIKNILPKPMKPSLDL
FT                   ESLCKETTSTMKKSKMHCMKSGENQNKNVKHFYEMGTPQIIGTYIQPLHHNTNSFNQNN
FT                   FPKNHMFPLLPSSPFFQPPNFRTNLTQASSTFIPLPHANKSTNIYGMPSYLIPENKPQN
FT                   LTVTVVPNKDKDSIEKEAKHLKALLDSSSKGIVNSTPDYQKIQPSTLSNYNDKESDFSF
FT                   GKNDNYEHAEYSEQNCNDENDTENNYNSFVNEFYDPHNSISYNNVNEFLKNSNQKNQQH
FT                   AFRLESNEEVARKVHKEFTYPKGTSLNKINILNQNYKEEGEQQQENETKNNMNMQERDE
FT                   ERQTMKKDSSIPKRTQLSKKKEHNNNNIVLKKHEPSTCFKNPKTYINIRLGKPKKLYIT
FT                   NSSDPIDKKLSEWHNTHNSQIGWKKYRRGVYTFGKTEVILSLVHDKIIVKKINGKHIKD
FT                   NLLTVEKFVSLNELYEIQQEENDNMLKKRGVKFFNF"
     MKSLYQMNHI GHPFMYPKMD ITKMNKTNNQ NIPNKAHNPN NSSNMNTTKK SYGTSLNYIK        60
     KENSSKNSIY NNYEYLDASH LEMLDLNKNI KNILPKPMKP SLDLESLCKE TTSTMKKSKM       120
     HCMKSGENQN KNVKHFYEMG TPQIIGTYIQ PLHHNTNSFN QNNFPKNHMF PLLPSSPFFQ       180
     PPNFRTNLTQ ASSTFIPLPH ANKSTNIYGM PSYLIPENKP QNLTVTVVPN KDKDSIEKEA       240
     KHLKALLDSS SKGIVNSTPD YQKIQPSTLS NYNDKESDFS FGKNDNYEHA EYSEQNCNDE       300
     NDTENNYNSF VNEFYDPHNS ISYNNVNEFL KNSNQKNQQH AFRLESNEEV ARKVHKEFTY       360
     PKGTSLNKIN ILNQNYKEEG EQQQENETKN NMNMQERDEE RQTMKKDSSI PKRTQLSKKK       420
     EHNNNNIVLK KHEPSTCFKN PKTYINIRLG KPKKLYITNS SDPIDKKLSE WHNTHNSQIG       480
     WKKYRRGVYT FGKTEVILSL VHDKIIVKKI NGKHIKDNLL TVEKFVSLNE LYEIQQEEND       540
     NMLKKRGVKF FNF                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page