(data stored in ACNUC9543 zone)

EMBL: AL844507.PE48

AL844507.PE48        Location/Qualifiers
FT   CDS             290902..291183
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0805200"
FT                   /product="gamete release protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0805200"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0119:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAP7"
FT                   /protein_id="CAD51314.1"
FT                   /translation="MSYNGYVPPNEDTPIPYGMSILPGNKDDDVPPNVTYTVGPIINDD
FT                   HFQMNLGGVVPSSWSLNQIAHYIKFAGPDDSVFAEKAKDLLREKGYQI"
     MSYNGYVPPN EDTPIPYGMS ILPGNKDDDV PPNVTYTVGP IINDDHFQMN LGGVVPSSWS        60
     LNQIAHYIKF AGPDDSVFAE KAKDLLREKG YQI                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page