(data stored in ACNUC9543 zone)

EMBL: AL844507.PE51

AL844507.PE51        Location/Qualifiers
FT   CDS             complement(305295..308549)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0805500"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0805500"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.201:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4R6"
FT                   /protein_id="CAX64092.1"
FT                   /translation="MNEETTTRTLLDIPGYYYDKKKNRYFLINNELKKELKKEEFNKSV
FT                   NNAKKKNRDTNNAETKKWGKKKFHQIHGIKEMKKKKKNANNNKLNNNIKNYNEEDGINT
FT                   IYTKKKSYNIINSKETKLELINNELNFLKKNICENQNIFNLIKRIKNYNFKEDSILSLP
FT                   PIFINSNSCEYIQVEDLCEYSSNKNSFCHKENDCLDILKSPRSFNNKRTDNIDVSLNDY
FT                   NYFNSSQKLIDKYKRKNKNEFDNFNKNESFDTYRKYRKNSIFSNQTDEYNVSNYNYTNK
FT                   KYYCDNKYNLTYCKNGNNMFSCINPDYIEENLLIPKLYGRTYEKLNSCNIKNIKSKIRV
FT                   NRYKANFYYFYNNTYDAFALEANNTSREMNMNNNNDNDANNDSNDNNNNNNNNNNSNIY
FT                   NNNIYNNNIYNNNIYNNNSGRHFISFNNISSDTIYQEMEVQSLEDSHMPIGHLDAVTNE
FT                   TRISKTHKPSESFFHLFSNPQYDDIVFSTTKENNFSFSLGAIDMNNFVQKNKKSSIYDV
FT                   IHENVYYSTDTKYLCSYSKEKSELLCISPQILSHFNIFNGEYVAYSSYPNTKDEKSLLC
FT                   LLSIKSFFQCNPKIEIYSFPGEVNYFKLFPSIQSDNYNNNNYSLHPTSDDYSFYHNNEI
FT                   DKIFICGSYPCFSFSTLKNNVTYCIWDSKKLKVQDLLSMNEDLTSYIENIINGKQFNVY
FT                   QQFENNSQKKLRLFSSKKRKKKISKEQNKNQHETFTDELYENNTKMNNDNKIKFCKKES
FT                   YNESDLYKGNSEHFKNVHGTFNNKKTHDYSYRHFDNNNNNNNNYNPKKSPNSANSIEKI
FT                   KNKCYFSYNHSSQSSLKYNYNDNKKKGICCENIKKSDNNIFLCCNTEYLYLCDLRCNLL
FT                   NTISKLKPNEGYVNKIYSLNNNVQYVSSKTNNHIGLYDMRYINYKHNDETKSNLIVSYE
FT                   RFIDNDNLKKHLNDFYVIDNEQYIVSLDTYTSSVYIYDIMGTTTKIINLDGNSEYSKNN
FT                   VLHCYTNLSKIPYIYSCRKYDDYYYNYYKQKIYETKATDSKYVNHFNPMKSYPKKDLFI
FT                   GLNVQSILPLFYIKQKYNKHNFISINEGGFICTINI"
     MNEETTTRTL LDIPGYYYDK KKNRYFLINN ELKKELKKEE FNKSVNNAKK KNRDTNNAET        60
     KKWGKKKFHQ IHGIKEMKKK KKNANNNKLN NNIKNYNEED GINTIYTKKK SYNIINSKET       120
     KLELINNELN FLKKNICENQ NIFNLIKRIK NYNFKEDSIL SLPPIFINSN SCEYIQVEDL       180
     CEYSSNKNSF CHKENDCLDI LKSPRSFNNK RTDNIDVSLN DYNYFNSSQK LIDKYKRKNK       240
     NEFDNFNKNE SFDTYRKYRK NSIFSNQTDE YNVSNYNYTN KKYYCDNKYN LTYCKNGNNM       300
     FSCINPDYIE ENLLIPKLYG RTYEKLNSCN IKNIKSKIRV NRYKANFYYF YNNTYDAFAL       360
     EANNTSREMN MNNNNDNDAN NDSNDNNNNN NNNNNSNIYN NNIYNNNIYN NNIYNNNSGR       420
     HFISFNNISS DTIYQEMEVQ SLEDSHMPIG HLDAVTNETR ISKTHKPSES FFHLFSNPQY       480
     DDIVFSTTKE NNFSFSLGAI DMNNFVQKNK KSSIYDVIHE NVYYSTDTKY LCSYSKEKSE       540
     LLCISPQILS HFNIFNGEYV AYSSYPNTKD EKSLLCLLSI KSFFQCNPKI EIYSFPGEVN       600
     YFKLFPSIQS DNYNNNNYSL HPTSDDYSFY HNNEIDKIFI CGSYPCFSFS TLKNNVTYCI       660
     WDSKKLKVQD LLSMNEDLTS YIENIINGKQ FNVYQQFENN SQKKLRLFSS KKRKKKISKE       720
     QNKNQHETFT DELYENNTKM NNDNKIKFCK KESYNESDLY KGNSEHFKNV HGTFNNKKTH       780
     DYSYRHFDNN NNNNNNYNPK KSPNSANSIE KIKNKCYFSY NHSSQSSLKY NYNDNKKKGI       840
     CCENIKKSDN NIFLCCNTEY LYLCDLRCNL LNTISKLKPN EGYVNKIYSL NNNVQYVSSK       900
     TNNHIGLYDM RYINYKHNDE TKSNLIVSYE RFIDNDNLKK HLNDFYVIDN EQYIVSLDTY       960
     TSSVYIYDIM GTTTKIINLD GNSEYSKNNV LHCYTNLSKI PYIYSCRKYD DYYYNYYKQK      1020
     IYETKATDSK YVNHFNPMKS YPKKDLFIGL NVQSILPLFY IKQKYNKHNF ISINEGGFIC      1080
     TINI                                                                   1084
//

If you have problems or comments...

PBIL Back to PBIL home page