(data stored in ACNUC9543 zone)

EMBL: AL844507.PE52

AL844507.PE52        Location/Qualifiers
FT   CDS             312034..312960
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0805600"
FT                   /product="PAP2-like protein, putative"
FT                   /EC_number="3.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0805600"
FT                   /db_xref="GOA:A0A143ZY93"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZY93"
FT                   /protein_id="CZT62746.1"
FT                   /translation="MLTKVYLPTLLHVGYLFNTIQCINIINYLIFGGSDKDSPNKNSSD
FT                   NKEEKNKKMEEYIDEKMKINLRSKKINSLKPIYTNTELETNYYIDNNETFKKLYANYPI
FT                   CEAKYKLVDKLKSFKIFKKLMTDKPKKIILFKTCIIELYGMLSVTIRNVNNFSSVIATV
FT                   YGYVPFLIMILTVFGFIITFNKNLLYIIFIMPTQTLISDLFLKRIFKKPRPINSALPTY
FT                   GMPSSHSSFAIALLTFLLLHITEQKKDKWSIITYVIATLTLLPIPWSRVEVEDHTVLQV
FT                   IVGSLVGIGFGFIFYFMKKYFFKHKDS"
     MLTKVYLPTL LHVGYLFNTI QCINIINYLI FGGSDKDSPN KNSSDNKEEK NKKMEEYIDE        60
     KMKINLRSKK INSLKPIYTN TELETNYYID NNETFKKLYA NYPICEAKYK LVDKLKSFKI       120
     FKKLMTDKPK KIILFKTCII ELYGMLSVTI RNVNNFSSVI ATVYGYVPFL IMILTVFGFI       180
     ITFNKNLLYI IFIMPTQTLI SDLFLKRIFK KPRPINSALP TYGMPSSHSS FAIALLTFLL       240
     LHITEQKKDK WSIITYVIAT LTLLPIPWSR VEVEDHTVLQ VIVGSLVGIG FGFIFYFMKK       300
     YFFKHKDS                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page