(data stored in ACNUC9543 zone)

EMBL: AL844507.PE53

AL844507.PE53        Location/Qualifiers
FT   CDS             complement(join(314172..314252,314434..318726))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0805700"
FT                   /product="serine/threonine protein kinase, FIKK family"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0805700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.203:mRNA"
FT                   /db_xref="GOA:C0H4R8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4R8"
FT                   /protein_id="CAX64094.1"
FT                   /translation="MIRTSEKVEYCKSKTMTCDDDYLSLKSSKTLNIDNGEEEYEKLGN
FT                   ERRDVQNMNDAEDVSLYKNKKYNPKKNVDKNNVDKNNIDKGNVDKSNVDKNNIDKGNVD
FT                   KSNVDKSNVDKSNVDMCEGNNIKSTDRKSNNTKRNSSKYNGLEERDDEDNSNNNNNMNS
FT                   MYDRNMVNTTYYENVQHMISKDDNESFDNYPKESKDLSEKFMNKNMLDNNNNSNNNNNN
FT                   NNNNNTIMNEEDIFMKYIEDTKNNDSSKNFVNDKEFVCTMSKDKYSEMNRSTTEIFDNM
FT                   NCIEYTDEYKQTNNQNFNSTIMMKEDTNKDDIKNVYRNISMDPKDCSGINFNEMNVEED
FT                   NNVVIGNNSNLESYENMGNENYTENIMYRNKKEQDEDEGDNDEEDKNSNNNYNLNDHNN
FT                   NTEEERKKNDTFYKKNGDYKNMLSNQDIYNETENINDSTTECTIVKDVPKCITNNHIQG
FT                   NLLDNTYLPKDVNANFRSYEQVDVKDNNSLLHTPIGCENKNKSYVNFPFNTVENKNIHI
FT                   TMEEEKYRDHNKVHHEIDDNGYIINSRDDAVNNKDSFYKSLSQQIYIDKNGSKYNVDIS
FT                   NDLFKKKCNINDKNMKNNYNENNDILRGAGQNDMPNNMHNISQKGFHLNQEGINDMLRN
FT                   QNNIAFQNSQYNGYIKDEQNIMNNLCERIEPSYIDSTSKRDSEGTKSAVHKNNINRNNN
FT                   NYNGNINKNNNNIHGNRNSNNIHGNRNSNNIHGNRNSNNIHSNRNSNNTHSNRNSNNTH
FT                   SNRNSNNSNRNNYNSFVVPGNMNSNNNDNNDKSYNNDKSYNNDNNYNNDNSYDKSLDEY
FT                   FRNNLPEDIIKNIKYENPSNTYNDLLNNRDYDLISKIKENPVYYSSEKEKKRMKNKDMK
FT                   QPKYVSNEKLDLDEHTHIYKNNNEDNNYNSMNRDTTIISKCDNPEMHYGQGNSYILPTC
FT                   QRNDLLKDDRNPMLSISKQKIKNIWSKFKNNTCKEHNVNRISESKNNNYVHKMEIMNIP
FT                   KKGLGNEYYNYPYDNNNNNNNINNNNNNINNNSNSNNIINNKECINKPIIYMNHINNNN
FT                   MDKQMRPKCIFNWKIAKKSLMKMLHSAHNFYFNGVKYSDWKFTCIPTLGFSKSSNRVQQ
FT                   MYRAFVVPKDSNVKKEVKLFIKKIPIYIWVKQFNLMNEYDGEYVTDGENFVMEATALAF
FT                   LNEYHPGITPKLYKILYEPDNKYFNEGLSQKSMYNNLNVFNDMLSERLKCNVGGNIVIV
FT                   SEFFNEDILDFIDRRQKKYNMKISNNEKSFILYQCLKLLIRLHDAGLSHLDLTPENILI
FT                   SDNYELRFCDLSKSTPIYTYNLRHIKDMNRLYLFESCEPTIAKGAYMPPECWKIYWKYD
FT                   TMKIKNPLKDLKHITDQEKRKQFYFDVSNADKFMLGVFFFWIWTNGNLWKCSDPLQDED
FT                   FFYFVKCDMNFDNFELTKNWPNELKDIIKQLLHVEQRKKLNLKDLSAHPWWSFKL"
     MIRTSEKVEY CKSKTMTCDD DYLSLKSSKT LNIDNGEEEY EKLGNERRDV QNMNDAEDVS        60
     LYKNKKYNPK KNVDKNNVDK NNIDKGNVDK SNVDKNNIDK GNVDKSNVDK SNVDKSNVDM       120
     CEGNNIKSTD RKSNNTKRNS SKYNGLEERD DEDNSNNNNN MNSMYDRNMV NTTYYENVQH       180
     MISKDDNESF DNYPKESKDL SEKFMNKNML DNNNNSNNNN NNNNNNNTIM NEEDIFMKYI       240
     EDTKNNDSSK NFVNDKEFVC TMSKDKYSEM NRSTTEIFDN MNCIEYTDEY KQTNNQNFNS       300
     TIMMKEDTNK DDIKNVYRNI SMDPKDCSGI NFNEMNVEED NNVVIGNNSN LESYENMGNE       360
     NYTENIMYRN KKEQDEDEGD NDEEDKNSNN NYNLNDHNNN TEEERKKNDT FYKKNGDYKN       420
     MLSNQDIYNE TENINDSTTE CTIVKDVPKC ITNNHIQGNL LDNTYLPKDV NANFRSYEQV       480
     DVKDNNSLLH TPIGCENKNK SYVNFPFNTV ENKNIHITME EEKYRDHNKV HHEIDDNGYI       540
     INSRDDAVNN KDSFYKSLSQ QIYIDKNGSK YNVDISNDLF KKKCNINDKN MKNNYNENND       600
     ILRGAGQNDM PNNMHNISQK GFHLNQEGIN DMLRNQNNIA FQNSQYNGYI KDEQNIMNNL       660
     CERIEPSYID STSKRDSEGT KSAVHKNNIN RNNNNYNGNI NKNNNNIHGN RNSNNIHGNR       720
     NSNNIHGNRN SNNIHSNRNS NNTHSNRNSN NTHSNRNSNN SNRNNYNSFV VPGNMNSNNN       780
     DNNDKSYNND KSYNNDNNYN NDNSYDKSLD EYFRNNLPED IIKNIKYENP SNTYNDLLNN       840
     RDYDLISKIK ENPVYYSSEK EKKRMKNKDM KQPKYVSNEK LDLDEHTHIY KNNNEDNNYN       900
     SMNRDTTIIS KCDNPEMHYG QGNSYILPTC QRNDLLKDDR NPMLSISKQK IKNIWSKFKN       960
     NTCKEHNVNR ISESKNNNYV HKMEIMNIPK KGLGNEYYNY PYDNNNNNNN INNNNNNINN      1020
     NSNSNNIINN KECINKPIIY MNHINNNNMD KQMRPKCIFN WKIAKKSLMK MLHSAHNFYF      1080
     NGVKYSDWKF TCIPTLGFSK SSNRVQQMYR AFVVPKDSNV KKEVKLFIKK IPIYIWVKQF      1140
     NLMNEYDGEY VTDGENFVME ATALAFLNEY HPGITPKLYK ILYEPDNKYF NEGLSQKSMY      1200
     NNLNVFNDML SERLKCNVGG NIVIVSEFFN EDILDFIDRR QKKYNMKISN NEKSFILYQC      1260
     LKLLIRLHDA GLSHLDLTPE NILISDNYEL RFCDLSKSTP IYTYNLRHIK DMNRLYLFES      1320
     CEPTIAKGAY MPPECWKIYW KYDTMKIKNP LKDLKHITDQ EKRKQFYFDV SNADKFMLGV      1380
     FFFWIWTNGN LWKCSDPLQD EDFFYFVKCD MNFDNFELTK NWPNELKDII KQLLHVEQRK      1440
     KLNLKDLSAH PWWSFKL                                                     1457
//

If you have problems or comments...

PBIL Back to PBIL home page