(data stored in ACNUC9543 zone)

EMBL: AL844507.PE54

AL844507.PE54        Location/Qualifiers
FT   CDS             complement(322367..323677)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0805800"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0805800"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZVZ5"
FT                   /protein_id="CZT62747.1"
FT                   /translation="MTIVPNKCYSYNELTKYTCHHKNKERLYKTRNLIIYSFSVIISWI
FT                   NSMSICDKIVNEYNIYDLIKSGVVLLKIIKIYRPHLEIINIFSKAIKKKCALHNLEKVL
FT                   EVVYKNNPHCYTMVSSIDIYDMKRTKVNLFLIQIFDMFEFQSLKKISTPLLRWYDNSLK
FT                   TFSLRLNERTINDPFYINKEYDKQKYTFQMIEGEYRYKKNNEINDKKEDYDNIKENLLY
FT                   NSEKEVLKDFASYILYKDKEEHEQNKNKIKINNNKYNNDNHRCCSSDGDIPHIVKDFSN
FT                   CIKIFFIFYKYGYILKKELINIFQSDRKNNIFYSLKKLMKKLHIPIVLQNIYLNNPCEV
FT                   VLILQLKYIYNFIMNNDKNLFSNYYIKEKNIYTPHEKKLYLNYEEETNKKNCIPRNNFV
FT                   HKNKLSLNDNFKKERTEEIRQMFYDKIRKHMKKYDRK"
     MTIVPNKCYS YNELTKYTCH HKNKERLYKT RNLIIYSFSV IISWINSMSI CDKIVNEYNI        60
     YDLIKSGVVL LKIIKIYRPH LEIINIFSKA IKKKCALHNL EKVLEVVYKN NPHCYTMVSS       120
     IDIYDMKRTK VNLFLIQIFD MFEFQSLKKI STPLLRWYDN SLKTFSLRLN ERTINDPFYI       180
     NKEYDKQKYT FQMIEGEYRY KKNNEINDKK EDYDNIKENL LYNSEKEVLK DFASYILYKD       240
     KEEHEQNKNK IKINNNKYNN DNHRCCSSDG DIPHIVKDFS NCIKIFFIFY KYGYILKKEL       300
     INIFQSDRKN NIFYSLKKLM KKLHIPIVLQ NIYLNNPCEV VLILQLKYIY NFIMNNDKNL       360
     FSNYYIKEKN IYTPHEKKLY LNYEEETNKK NCIPRNNFVH KNKLSLNDNF KKERTEEIRQ       420
     MFYDKIRKHM KKYDRK                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page