(data stored in ACNUC9543 zone)

EMBL: AL844507.PE55

AL844507.PE55        Location/Qualifiers
FT   CDS             complement(join(324279..324365,324509..324745,
FT                   324856..324996,325109..325201,325305..325458,
FT                   325618..325655))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0805900"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0805900"
FT                   /db_xref="InterPro:IPR019129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZVL3"
FT                   /protein_id="CZT62748.1"
FT                   /translation="MSYVDLSGYKIPKKMFDELNPFERHKLMMSLRSLEEEKKKENKNE
FT                   KYLSDYDILRKKYNFIHDVENEKNSLLQNYYKSICNKYVICDLSKYKETKIGLRWRTEE
FT                   EIIKGKGHVICSSKKCNNTDLNTYEFLFQYIEQGIKKETNVKVRACMDCAYKLHYRKIN
FT                   KYLKKKEKEKKKKKIKEKKKRKKKKGKKNKSDLTSESDLSSSYNSEDRSQSKREKLYYV
FT                   KKKLEKISIKKKEEMNEDNLFFHDLLF"
     MSYVDLSGYK IPKKMFDELN PFERHKLMMS LRSLEEEKKK ENKNEKYLSD YDILRKKYNF        60
     IHDVENEKNS LLQNYYKSIC NKYVICDLSK YKETKIGLRW RTEEEIIKGK GHVICSSKKC       120
     NNTDLNTYEF LFQYIEQGIK KETNVKVRAC MDCAYKLHYR KINKYLKKKE KEKKKKKIKE       180
     KKKRKKKKGK KNKSDLTSES DLSSSYNSED RSQSKREKLY YVKKKLEKIS IKKKEEMNED       240
     NLFFHDLLF                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page