(data stored in ACNUC9543 zone)

EMBL: AL844507.PE57

AL844507.PE57        Location/Qualifiers
FT   CDS             330651..332678
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806100"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZXM1"
FT                   /protein_id="CZT62749.1"
FT                   /translation="MVYDEEGKEKGLQKKKKGINKRNTRIFLRDKIKDIEIQCGKLKDY
FT                   LKKKEEEKKIFQISTVLLKQYHSYLNNKLYNNISSCLPIFHHIFVTSCGIIFTNNDCYI
FT                   NDEKKKINQKKKIKNINNHLLYCKNGKSSFSDHCIYDEDICKNISSIYYPMKGKNKSTL
FT                   IKQTNILYEEKENMLCTTLKDQSKKKKSCYVYNIQNNNINNNMYIESMTSENNKKKLKE
FT                   KNIIYLSSLEGKKKKMYKKYRNDQDTSTLYTHNNNNNNNNNKILIKNKKKKCTTIYNEN
FT                   NKSISSTILNTSFNNIKKKKKMDYLNRKFIDKKCSTDKNLIISSSHTVDTISELVNMNN
FT                   SSSDNNISTYNDIHVQNVCNKSNKIKRYNHNNIIKKIKNPTKYEISSSLSILLGCKTNA
FT                   HNYYNDIYDEEYKKKYNHINKMNTQYNEPYNIQYVKEKHKTETETETKTETETKTKAKK
FT                   KKKKKKEKKDESYIDSYIDLIKNVKVFSFFENKEQIIQNNTFTNFFNNIKNFFFFSSND
FT                   KKEQKENNTSDHNNPYEQNKNINNKRQYNILKYQCVIKSKGIKIFLCVCPNCSKHFYLL
FT                   IKKGSQKKMISKVLHPSYFVTLVKNLKKQKINLLKDEYEQMSDDNPSMKNIPYLDITTV
FT                   EFFNDSLYYDETVQDFCQCYLKINETTNNFYDNMDILLYI"
     MVYDEEGKEK GLQKKKKGIN KRNTRIFLRD KIKDIEIQCG KLKDYLKKKE EEKKIFQIST        60
     VLLKQYHSYL NNKLYNNISS CLPIFHHIFV TSCGIIFTNN DCYINDEKKK INQKKKIKNI       120
     NNHLLYCKNG KSSFSDHCIY DEDICKNISS IYYPMKGKNK STLIKQTNIL YEEKENMLCT       180
     TLKDQSKKKK SCYVYNIQNN NINNNMYIES MTSENNKKKL KEKNIIYLSS LEGKKKKMYK       240
     KYRNDQDTST LYTHNNNNNN NNNKILIKNK KKKCTTIYNE NNKSISSTIL NTSFNNIKKK       300
     KKMDYLNRKF IDKKCSTDKN LIISSSHTVD TISELVNMNN SSSDNNISTY NDIHVQNVCN       360
     KSNKIKRYNH NNIIKKIKNP TKYEISSSLS ILLGCKTNAH NYYNDIYDEE YKKKYNHINK       420
     MNTQYNEPYN IQYVKEKHKT ETETETKTET ETKTKAKKKK KKKKEKKDES YIDSYIDLIK       480
     NVKVFSFFEN KEQIIQNNTF TNFFNNIKNF FFFSSNDKKE QKENNTSDHN NPYEQNKNIN       540
     NKRQYNILKY QCVIKSKGIK IFLCVCPNCS KHFYLLIKKG SQKKMISKVL HPSYFVTLVK       600
     NLKKQKINLL KDEYEQMSDD NPSMKNIPYL DITTVEFFND SLYYDETVQD FCQCYLKINE       660
     TTNNFYDNMD ILLYI                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page