(data stored in ACNUC9543 zone)

EMBL: AL844507.PE59

AL844507.PE59        Location/Qualifiers
FT   CDS             complement(join(337902..337966,338093..338337,
FT                   338450..343254))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806300"
FT                   /product="ferlin-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.134:mRNA"
FT                   /db_xref="GOA:C0H4S2"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR012968"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037721"
FT                   /db_xref="InterPro:IPR037724"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4S2"
FT                   /protein_id="CAX64098.1"
FT                   /translation="MSSIAKKTQYNIKVDIHEVKDLSFRESANEKEIIPNPYIEVTVNN
FT                   EKKSTTKKNQAVNVVYNTSFNFSQDLTDYKFERTSVDVCVLHKYTIQSALIGKCSFGLN
FT                   FVYSKVQHWLYRIWVKLRNPDLPLDDVGFLLISVGVYGPGDSIPIVNDSVKTDIHEDVF
FT                   SNKGLDIHITHYDLCLNIFRGQDIELIGNSTLFSNILEPYVKVSHNGFEECTKVIRNDP
FT                   NPVWNLSIHIPTCTPCYDKNILVELINGEHNGIVIYSILLDFFEILKRELAPRWFNIYY
FT                   NPQNQIMPRYSEYMQNGSIQINLNSTTTNNNNNNSTAINPLGNYLFSGAAEKIFKNATQ
FT                   AININDILGVTKVQNMFTDDTLKEFYLYGGRIFLSANATKTHSPGPICIKSAKVEVDAP
FT                   NKEYIFCADIYEILSVRNNKMGNYDDYDGGYTTTNNNNKNKNNNNENNNNDNNDNIYNS
FT                   NNIYNSASEKRRSRYNNNYDASGESIICVCALGPHKLKTIPLLPNEVGSYVLNENVGRI
FT                   DEFRIFLPQNNNEQIYDIFLYIYIKSNLAVTNWINNRRSIYNSVLLNNEYESGDRNKKQ
FT                   GLHKMGSINNISEDIMQDSDFLNNYKLTSYVRIPYKYLLLNENKPKWFSMKNIETNVHE
FT                   YNISFFANLIPYHAYKKRPKRLEYKLSRYFFRALIYEGLHFPAKGYNAFPDPYIKIELA
FT                   GQVIKTSTILHTLNPNYYEAYEVQVILPTNLNLAPDISIEALSVNKSFLYNDDILLGSC
FT                   TFPIMKVPTEWKKSPIWIPLKSSQYKKCKAKLLVAFELVPVEKVLDDTYPFYDDIRPST
FT                   LPGHVSLFLIGIRMFKPLKDPSVTVCFGRDVDDTSQFLWHETTNKVISGKEGNWNFLKY
FT                   FSLDVMLPKRMQHHSFLEVRIEDRILNSGFTGTASSNMHAVNATNNNLLIGTAYITLNP
FT                   LLPWLDNYEKNECVELFKLHLLEEVLIEDAEMDRKSYNSALIYKKSSIMSRKLSNDNFE
FT                   TQQMGEENGIFNDIPMNTLEENVTIKGDDSSDDEKDNSYDDEKDNSYDDEKDNSYDDEK
FT                   DNSYDGDDKSGHYYHTWEDNNNNNNNNVTSDHTCKHKNEHNNNKKEDEKRKREKKNTYT
FT                   TNHDKRENNNTHINNNYKHVIDIKKKKRKKNIKKYINNEYVPYNDPDFSNVRIEETLEH
FT                   VCFKINDLTKKENTYIYYNDEQETLCDSISSEKRKKLKDIHFFKGGKHDDKEKKSTIID
FT                   GKQPTTIYGFNEDMLNFQLSLADDDEQEEIQRDEMLYEYEVDMNTDDLPYLRATIFRCT
FT                   DSGVPEAVGYLKYICNVYDEKTMYLKKEMIKKCDDLVREYRLTRNLVVRAYIIQARGLN
FT                   PPSGATDITTYIWIKNSNDMTNIPGGLSHNIKDTGHTKKQGYKPEFNRCYQLLCSFPDE
FT                   SIVQVCIMNQGSLSDEIIGYTYIDMEDRYFNQKIRQLMIDDLMPIELRSLKLENSTISH
FT                   GSLRCWFEIFNEEFAQLNPIKVLCSNEPDDYQLRLVIWKVNNAAMDDNSTISLFVRCIY
FT                   TDEDREDIRDTDTHYNSKDGKGIFNWRFVYNIKIPTNATNIKIQIHNYALLSSNEPIGE
FT                   ATLDLSAHFYRARKKKGYYPIPRFWLSCKHPAHKNKVRGNVEIEGSILIKSEAELDPVG
FT                   NGRDEPNKDPYLPPVTENRTYVDWVMINEKFGAATASIMHGLKWTGVWIVVGVIVIGIF
FT                   FLIFLFK"
     MSSIAKKTQY NIKVDIHEVK DLSFRESANE KEIIPNPYIE VTVNNEKKST TKKNQAVNVV        60
     YNTSFNFSQD LTDYKFERTS VDVCVLHKYT IQSALIGKCS FGLNFVYSKV QHWLYRIWVK       120
     LRNPDLPLDD VGFLLISVGV YGPGDSIPIV NDSVKTDIHE DVFSNKGLDI HITHYDLCLN       180
     IFRGQDIELI GNSTLFSNIL EPYVKVSHNG FEECTKVIRN DPNPVWNLSI HIPTCTPCYD       240
     KNILVELING EHNGIVIYSI LLDFFEILKR ELAPRWFNIY YNPQNQIMPR YSEYMQNGSI       300
     QINLNSTTTN NNNNNSTAIN PLGNYLFSGA AEKIFKNATQ AININDILGV TKVQNMFTDD       360
     TLKEFYLYGG RIFLSANATK THSPGPICIK SAKVEVDAPN KEYIFCADIY EILSVRNNKM       420
     GNYDDYDGGY TTTNNNNKNK NNNNENNNND NNDNIYNSNN IYNSASEKRR SRYNNNYDAS       480
     GESIICVCAL GPHKLKTIPL LPNEVGSYVL NENVGRIDEF RIFLPQNNNE QIYDIFLYIY       540
     IKSNLAVTNW INNRRSIYNS VLLNNEYESG DRNKKQGLHK MGSINNISED IMQDSDFLNN       600
     YKLTSYVRIP YKYLLLNENK PKWFSMKNIE TNVHEYNISF FANLIPYHAY KKRPKRLEYK       660
     LSRYFFRALI YEGLHFPAKG YNAFPDPYIK IELAGQVIKT STILHTLNPN YYEAYEVQVI       720
     LPTNLNLAPD ISIEALSVNK SFLYNDDILL GSCTFPIMKV PTEWKKSPIW IPLKSSQYKK       780
     CKAKLLVAFE LVPVEKVLDD TYPFYDDIRP STLPGHVSLF LIGIRMFKPL KDPSVTVCFG       840
     RDVDDTSQFL WHETTNKVIS GKEGNWNFLK YFSLDVMLPK RMQHHSFLEV RIEDRILNSG       900
     FTGTASSNMH AVNATNNNLL IGTAYITLNP LLPWLDNYEK NECVELFKLH LLEEVLIEDA       960
     EMDRKSYNSA LIYKKSSIMS RKLSNDNFET QQMGEENGIF NDIPMNTLEE NVTIKGDDSS      1020
     DDEKDNSYDD EKDNSYDDEK DNSYDDEKDN SYDGDDKSGH YYHTWEDNNN NNNNNVTSDH      1080
     TCKHKNEHNN NKKEDEKRKR EKKNTYTTNH DKRENNNTHI NNNYKHVIDI KKKKRKKNIK      1140
     KYINNEYVPY NDPDFSNVRI EETLEHVCFK INDLTKKENT YIYYNDEQET LCDSISSEKR      1200
     KKLKDIHFFK GGKHDDKEKK STIIDGKQPT TIYGFNEDML NFQLSLADDD EQEEIQRDEM      1260
     LYEYEVDMNT DDLPYLRATI FRCTDSGVPE AVGYLKYICN VYDEKTMYLK KEMIKKCDDL      1320
     VREYRLTRNL VVRAYIIQAR GLNPPSGATD ITTYIWIKNS NDMTNIPGGL SHNIKDTGHT      1380
     KKQGYKPEFN RCYQLLCSFP DESIVQVCIM NQGSLSDEII GYTYIDMEDR YFNQKIRQLM      1440
     IDDLMPIELR SLKLENSTIS HGSLRCWFEI FNEEFAQLNP IKVLCSNEPD DYQLRLVIWK      1500
     VNNAAMDDNS TISLFVRCIY TDEDREDIRD TDTHYNSKDG KGIFNWRFVY NIKIPTNATN      1560
     IKIQIHNYAL LSSNEPIGEA TLDLSAHFYR ARKKKGYYPI PRFWLSCKHP AHKNKVRGNV      1620
     EIEGSILIKS EAELDPVGNG RDEPNKDPYL PPVTENRTYV DWVMINEKFG AATASIMHGL      1680
     KWTGVWIVVG VIVIGIFFLI FLFK                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page