(data stored in ACNUC9543 zone)

EMBL: AL844507.PE6

AL844507.PE6         Location/Qualifiers
FT   CDS             complement(join(61138..61920,62043..62135))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0800600"
FT                   /product="Plasmodium exported protein (PHISTa), unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0800600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.163:mRNA"
FT                   /db_xref="GOA:Q8IAK5"
FT                   /db_xref="InterPro:IPR006526"
FT                   /db_xref="InterPro:IPR019111"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAK5"
FT                   /protein_id="CAD51358.1"
FT                   /translation="MKNTGSNFILKFFLFKCIFVVIIGILCMGILYLPNDRNNKVSSIK
FT                   SSEKYQRKLYDLQRIVKGRKKDSKLKNKSEGTNEQQNNKNNGNIVKNEELLSRSNKKCL
FT                   KVDLNREKLLKYFSSDKENIKDKDINYNDLTNNLNRKELLAVLETINEKTPRNDLINIW
FT                   SHVVGINRGEIDELTDKLIAYTEYYINKHNKHDININEMKTFLNINSKGWNDFKIECVK
FT                   KIACEDSVFSQRFYKILKKGKKIEEIKKLIKSYIEYADAIKKKEYENYIERFHESFEKY
FT                   VNSSRKKKKL"
     MKNTGSNFIL KFFLFKCIFV VIIGILCMGI LYLPNDRNNK VSSIKSSEKY QRKLYDLQRI        60
     VKGRKKDSKL KNKSEGTNEQ QNNKNNGNIV KNEELLSRSN KKCLKVDLNR EKLLKYFSSD       120
     KENIKDKDIN YNDLTNNLNR KELLAVLETI NEKTPRNDLI NIWSHVVGIN RGEIDELTDK       180
     LIAYTEYYIN KHNKHDININ EMKTFLNINS KGWNDFKIEC VKKIACEDSV FSQRFYKILK       240
     KGKKIEEIKK LIKSYIEYAD AIKKKEYENY IERFHESFEK YVNSSRKKKK L                291
//

If you have problems or comments...

PBIL Back to PBIL home page