(data stored in ACNUC9543 zone)

EMBL: AL844507.PE60

AL844507.PE60        Location/Qualifiers
FT   CDS             344288..344821
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806400"
FT                   /product="UDP-N-acetylglucosamine transferase subunit
FT                   ALG13, putative"
FT                   /EC_number="2.4.1.141"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.133:mRNA"
FT                   /db_xref="GOA:Q8IAQ4"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR039042"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAQ4"
FT                   /protein_id="CAD51307.1"
FT                   /translation="MSSDMHLFVTVGSTNFDELIKYIDDEQFHFFLRNLGFSYMTIQIG
FT                   NGTYIPKLIYTNDNNINNNKLLKEVKYFTYKTNLDKYFEKAHFILSHSGAGTTLECLRK
FT                   KKKILIVVNHKLMSNHQSEFANYMHSCNYLDICNNLQNLKQNIHLSLKKDTYNAFPQAD
FT                   AQPFLKDLYNLIYN"
     MSSDMHLFVT VGSTNFDELI KYIDDEQFHF FLRNLGFSYM TIQIGNGTYI PKLIYTNDNN        60
     INNNKLLKEV KYFTYKTNLD KYFEKAHFIL SHSGAGTTLE CLRKKKKILI VVNHKLMSNH       120
     QSEFANYMHS CNYLDICNNL QNLKQNIHLS LKKDTYNAFP QADAQPFLKD LYNLIYN          177
//

If you have problems or comments...

PBIL Back to PBIL home page