(data stored in SCRATCH zone)

EMBL: AL844507.PE61

AL844507.PE61        Location/Qualifiers
FT   CDS             complement(345427..347454)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806500"
FT                   /product="DnaJ protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0115:mRNA"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR026894"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAQ5"
FT                   /protein_id="CAD51306.1"
FT                   /translation="MSNWNFFNDYLNWFNGTTESTTFHNRSSKKGSNKSVSTNSTSINT
FT                   NKNNINELSNSQPNNSGQTCDEMKASNDGFEKDVSKIKCAKKYNPFINIKEKYYKEYNN
FT                   MNTKKENNKSEKKCGIQIEGQNGNPSENPSENPSESQNENPIPCQIKKCDKENDQNIPK
FT                   SGNKNKDTNFFNQLGLSNWLPNYDMPIYNEYKKGYYLDKEAKEVLSKKGSKKSNVIKIG
FT                   GDSSNSNMNDFNVSDCGNNTCVDTTYYDALNIKPTAKLSEIKTSYYKLALKYHPDKNAN
FT                   DPEAKLKFQKINEAYQVLSDDERRRQYNKYGLNATKDMILIDPSIFFMMLFSSEELSDY
FT                   TGTLRIAFFVQLAFEGNMSIEDKKSSNQVMINEMEVEQKIREVELALLLRKRLQPYVDG
FT                   DVEWEEQMETEIKGLLESSFSSSILESIGWTYENVATSYIAEVTTLWGVGATVANIQAA
FT                   GRTIGNTFSAAKSMFNTVVTIKDFSLNSEKINSIKEKKDNLKTSSNNSLNNHSSSNKGS
FT                   SEQNGTNENLKCDNNQVNHKNNVNTSDNINNVNTSNTHENKEEEKKNTIIDKEENKALG
FT                   VIIKNVLTLVLWDIESTVRQATEKVIRDEDVNIETRLKRAEGMKFLGKLMQKWSKIKND
FT                   KCDTNDIDATKLLEKAIIKASKMPNDEDQGDQDNIKREYL"
     MSNWNFFNDY LNWFNGTTES TTFHNRSSKK GSNKSVSTNS TSINTNKNNI NELSNSQPNN        60
     SGQTCDEMKA SNDGFEKDVS KIKCAKKYNP FINIKEKYYK EYNNMNTKKE NNKSEKKCGI       120
     QIEGQNGNPS ENPSENPSES QNENPIPCQI KKCDKENDQN IPKSGNKNKD TNFFNQLGLS       180
     NWLPNYDMPI YNEYKKGYYL DKEAKEVLSK KGSKKSNVIK IGGDSSNSNM NDFNVSDCGN       240
     NTCVDTTYYD ALNIKPTAKL SEIKTSYYKL ALKYHPDKNA NDPEAKLKFQ KINEAYQVLS       300
     DDERRRQYNK YGLNATKDMI LIDPSIFFMM LFSSEELSDY TGTLRIAFFV QLAFEGNMSI       360
     EDKKSSNQVM INEMEVEQKI REVELALLLR KRLQPYVDGD VEWEEQMETE IKGLLESSFS       420
     SSILESIGWT YENVATSYIA EVTTLWGVGA TVANIQAAGR TIGNTFSAAK SMFNTVVTIK       480
     DFSLNSEKIN SIKEKKDNLK TSSNNSLNNH SSSNKGSSEQ NGTNENLKCD NNQVNHKNNV       540
     NTSDNINNVN TSNTHENKEE EKKNTIIDKE ENKALGVIIK NVLTLVLWDI ESTVRQATEK       600
     VIRDEDVNIE TRLKRAEGMK FLGKLMQKWS KIKNDKCDTN DIDATKLLEK AIIKASKMPN       660
     DEDQGDQDNI KREYL                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page