(data stored in ACNUC9543 zone)

EMBL: AL844507.PE63

AL844507.PE63        Location/Qualifiers
FT   CDS             join(354472..361893,362018..362083,362166..362396)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806700"
FT                   /product="conserved Plasmodium membrane protein, unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806700"
FT                   /db_xref="GOA:A0A143ZVL6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZVL6"
FT                   /protein_id="CZT62750.1"
FT                   /translation="MERDELKKGHKVVLCEENNDGMKKSDEYFSYIDENNINDYINDEN
FT                   GNHDDNKYIHSDDNKYIHSDDNKYIHSDDNNHVNNCSHFSYVKDMLECDEEKKDVGFMI
FT                   SDKERYEFLKYADYFFHEYKDNVHIYREIKFVLKTNNPSLLCLLKNICLLGHIIYFYED
FT                   LYEQKLLTSKDINNIENILYKNEDTVSNNYTIIYNCFLFLLEIIKLSIHTGVQKFAYYQ
FT                   MIRNKKLIQTISYNNFNYNPNKIKNKEHFFIKKDNEALFIKDMITLHIVNMLNQTHKHI
FT                   RLYALKLSILFISHISKSNHIINHIMNIIFQQINFEEYIHALVLFLKLVPYLSHDVLYH
FT                   IIKKLYKSLIKKKDECSNVHSLFMHIKKGGMENENPQKNIHHEKVSPYKVENHNVDGEK
FT                   GIQVGLQKEDDGNKEEKNEKHISDKNEEYISAQETKNPKEENISHMYNYLDIFKDLKCY
FT                   NNNNYYEDMYFSKKNKKNTYINKMIYIINDHFSFTKCLYFAMIGSKLNELYPYVSYYLF
FT                   KKLWNIINKIFYIPYNQCDENKIVHLLDVLFYNTTLLSFTNIFLLNLQIIILKFLLNIS
FT                   QTYIMKKRYITFYSIRALLYLIKKKKLFICMDYYIYQDKIMSNQAYPFNCMNHFLYMST
FT                   FQYSDILHILSVILFNNNNNNINDCNDNNINDCNDNNINDCNDNNINDCNDNNINYCND
FT                   NNINDCNDNNINDCNDNNINDCNDNNINYCNDNNINDCNDNNINYCNDNNINDCNDNNI
FT                   NDCNDNNINYCNDNNNNYYYYYNCNTLSIYFFIKLIYKFFKVIQRGTAPNIFNIHNNNI
FT                   YRKKIKNVLNIKKNKHKYNIMNHKVFKDTNKNMHKHSYTNFNFSYFDLNINKFLTLFKN
FT                   VQDECIQKKDSSKVKHIKKKKVDDIKDETLKEFIKNDNKDDINKKDLIINNNKNQPFYN
FT                   QNEHEETGKFNFLITIDDANNTTNKQKHADIFFHNFICTAKNKHTNNNINIKNLNITLD
FT                   IIRKKKTKRKKKKKKNKKKNKTNKIKKKYIYKIKYCNPYKNKNNSIIHKLISKMEKREQ
FT                   TKKKNKKKYHTNQKNIGKTKKNKSSKKIRNQHDEKKINQIINHNIDDHNGYQDIDDHNG
FT                   YQDIDDHNGYQGIDDHNGYQNVDDHNGYQDIDDHNGYQGIDDHNGYQNVDDHNGYQDID
FT                   DHNGYQDIDDHNGYQDIDDHNDYQDIDDHNNYQDTDDHNNYNNITSSYTTSSSSCIYSS
FT                   SSNLYNEQDYDEENEKEKEMESTNFIKDTQQNCIISNNNSYDNNSFNSDALHNEINTFS
FT                   HSSDINKNIMSNINVGSDEISEISFSKNSIFNEDTNNFLFINNDKQNKCTNKSTDKNTN
FT                   KSTNKSTNKNTNKSTNKIYNTHYISYAFHFLKQNKINLGNLIDEHKLYYHNYNENNLFT
FT                   HFKNEFFKKGKEKNSDIPNIIVLKQIMFIKILFFLYKHNNLLIIKLYILKTLSILSKHL
FT                   IFEEDIENFIRIFNYFVTHFLKQNDFTNTQTSTLLKHDNNNNVHTHSTELLKKQKYTNH
FT                   IFQNIYKQNEKETLYSNNSYNSDHTSYLGSVIMSSDSSTQEQKKNKTNKKNYLNNFVNY
FT                   LLNKNHMLILEETNSSFYNKNVLKNFIRIYITDIIHKLLKYKNQIILNSILYIFTSNQI
FT                   IPFFNLFHIFNKEGIEQILKEPFFYLTVEKKYINEKEKEREKANQDEHININHTNNNLF
FT                   EITKGDHKNEDKKSINKYPISYHHSYLNILNKHFFQSFQFDNISFNNVKALFYFSFFNF
FT                   INHKDSMIIFRKKTLTFLNILNDIYFFKTNKYVFYREKYREKLFCVDKTNDFACTSQAN
FT                   NLTHAGKMNELLCTSQVNKKLQYNERVGVLSYNERINLKIESMNGHKYINIEDDSIDKK
FT                   KKIDIKYDIKNNDIKNNDIKNNDIKNNDIKSDDIKSDDIKSDDIKSDDIKSDDIKSDDI
FT                   KSDDNKSDDIKSDDIKSNDVNNSENSNKFSDDDDYYSSSSCSVSISCVSYKSVDDGSTV
FT                   HYVSDDDKESVDDDFSISSISNKSFKHRIIKSYDNLYNEDMSTNENIQMTCDIHECSYI
FT                   YMYKIGLYCIISGYYNYGYKIFTKLYMMVNNRDIKLWLECLLNYCKFYYLKKNQQKQST
FT                   YLYVRKKSDKNNMYYIKNNRDEFYHNHNDFVNHCNYNIGYINPSKCLEKAQECIKQIIS
FT                   YKENFFHVFLFLQIKKNIYQAIENLIILINDIKYEINYTVKYFTYNIEEYINFLKSIFV
FT                   YILLLSNFKYEFSRLSKRILYIYMVLIKTLFVICIFMKNKIIPYLFLNSSFLLNTLMDD
FT                   NYTSGDQQNESTSEDDDDGNTNKSTCKYNNVYHKDHYNEYIYNQDGNIINLKKKNTKFN
FT                   LFIWGDDYTGYNFTRLYLERKKERIIRKKFFSKELKDVDGKSFQEIFEYIINLWKVSGQ
FT                   HFFFYDHIHNLNEMYYNLFKDNIINKKKILNFLKIYLLILNKINYPTPPRFLSSRAFPC
FT                   VVSRAYIYKSNFGKMEYEVESVKCIGHLENAQAHVIKQFYYCNIKLVLRNKIIRNINVK
FT                   AKGVSVLYTFHIQIENEDLKNFYIFMIPLDKDKQILGQAKPTDFFIKYV"
     MERDELKKGH KVVLCEENND GMKKSDEYFS YIDENNINDY INDENGNHDD NKYIHSDDNK        60
     YIHSDDNKYI HSDDNNHVNN CSHFSYVKDM LECDEEKKDV GFMISDKERY EFLKYADYFF       120
     HEYKDNVHIY REIKFVLKTN NPSLLCLLKN ICLLGHIIYF YEDLYEQKLL TSKDINNIEN       180
     ILYKNEDTVS NNYTIIYNCF LFLLEIIKLS IHTGVQKFAY YQMIRNKKLI QTISYNNFNY       240
     NPNKIKNKEH FFIKKDNEAL FIKDMITLHI VNMLNQTHKH IRLYALKLSI LFISHISKSN       300
     HIINHIMNII FQQINFEEYI HALVLFLKLV PYLSHDVLYH IIKKLYKSLI KKKDECSNVH       360
     SLFMHIKKGG MENENPQKNI HHEKVSPYKV ENHNVDGEKG IQVGLQKEDD GNKEEKNEKH       420
     ISDKNEEYIS AQETKNPKEE NISHMYNYLD IFKDLKCYNN NNYYEDMYFS KKNKKNTYIN       480
     KMIYIINDHF SFTKCLYFAM IGSKLNELYP YVSYYLFKKL WNIINKIFYI PYNQCDENKI       540
     VHLLDVLFYN TTLLSFTNIF LLNLQIIILK FLLNISQTYI MKKRYITFYS IRALLYLIKK       600
     KKLFICMDYY IYQDKIMSNQ AYPFNCMNHF LYMSTFQYSD ILHILSVILF NNNNNNINDC       660
     NDNNINDCND NNINDCNDNN INDCNDNNIN YCNDNNINDC NDNNINDCND NNINDCNDNN       720
     INYCNDNNIN DCNDNNINYC NDNNINDCND NNINDCNDNN INYCNDNNNN YYYYYNCNTL       780
     SIYFFIKLIY KFFKVIQRGT APNIFNIHNN NIYRKKIKNV LNIKKNKHKY NIMNHKVFKD       840
     TNKNMHKHSY TNFNFSYFDL NINKFLTLFK NVQDECIQKK DSSKVKHIKK KKVDDIKDET       900
     LKEFIKNDNK DDINKKDLII NNNKNQPFYN QNEHEETGKF NFLITIDDAN NTTNKQKHAD       960
     IFFHNFICTA KNKHTNNNIN IKNLNITLDI IRKKKTKRKK KKKKNKKKNK TNKIKKKYIY      1020
     KIKYCNPYKN KNNSIIHKLI SKMEKREQTK KKNKKKYHTN QKNIGKTKKN KSSKKIRNQH      1080
     DEKKINQIIN HNIDDHNGYQ DIDDHNGYQD IDDHNGYQGI DDHNGYQNVD DHNGYQDIDD      1140
     HNGYQGIDDH NGYQNVDDHN GYQDIDDHNG YQDIDDHNGY QDIDDHNDYQ DIDDHNNYQD      1200
     TDDHNNYNNI TSSYTTSSSS CIYSSSSNLY NEQDYDEENE KEKEMESTNF IKDTQQNCII      1260
     SNNNSYDNNS FNSDALHNEI NTFSHSSDIN KNIMSNINVG SDEISEISFS KNSIFNEDTN      1320
     NFLFINNDKQ NKCTNKSTDK NTNKSTNKST NKNTNKSTNK IYNTHYISYA FHFLKQNKIN      1380
     LGNLIDEHKL YYHNYNENNL FTHFKNEFFK KGKEKNSDIP NIIVLKQIMF IKILFFLYKH      1440
     NNLLIIKLYI LKTLSILSKH LIFEEDIENF IRIFNYFVTH FLKQNDFTNT QTSTLLKHDN      1500
     NNNVHTHSTE LLKKQKYTNH IFQNIYKQNE KETLYSNNSY NSDHTSYLGS VIMSSDSSTQ      1560
     EQKKNKTNKK NYLNNFVNYL LNKNHMLILE ETNSSFYNKN VLKNFIRIYI TDIIHKLLKY      1620
     KNQIILNSIL YIFTSNQIIP FFNLFHIFNK EGIEQILKEP FFYLTVEKKY INEKEKEREK      1680
     ANQDEHININ HTNNNLFEIT KGDHKNEDKK SINKYPISYH HSYLNILNKH FFQSFQFDNI      1740
     SFNNVKALFY FSFFNFINHK DSMIIFRKKT LTFLNILNDI YFFKTNKYVF YREKYREKLF      1800
     CVDKTNDFAC TSQANNLTHA GKMNELLCTS QVNKKLQYNE RVGVLSYNER INLKIESMNG      1860
     HKYINIEDDS IDKKKKIDIK YDIKNNDIKN NDIKNNDIKN NDIKSDDIKS DDIKSDDIKS      1920
     DDIKSDDIKS DDIKSDDNKS DDIKSDDIKS NDVNNSENSN KFSDDDDYYS SSSCSVSISC      1980
     VSYKSVDDGS TVHYVSDDDK ESVDDDFSIS SISNKSFKHR IIKSYDNLYN EDMSTNENIQ      2040
     MTCDIHECSY IYMYKIGLYC IISGYYNYGY KIFTKLYMMV NNRDIKLWLE CLLNYCKFYY      2100
     LKKNQQKQST YLYVRKKSDK NNMYYIKNNR DEFYHNHNDF VNHCNYNIGY INPSKCLEKA      2160
     QECIKQIISY KENFFHVFLF LQIKKNIYQA IENLIILIND IKYEINYTVK YFTYNIEEYI      2220
     NFLKSIFVYI LLLSNFKYEF SRLSKRILYI YMVLIKTLFV ICIFMKNKII PYLFLNSSFL      2280
     LNTLMDDNYT SGDQQNESTS EDDDDGNTNK STCKYNNVYH KDHYNEYIYN QDGNIINLKK      2340
     KNTKFNLFIW GDDYTGYNFT RLYLERKKER IIRKKFFSKE LKDVDGKSFQ EIFEYIINLW      2400
     KVSGQHFFFY DHIHNLNEMY YNLFKDNIIN KKKILNFLKI YLLILNKINY PTPPRFLSSR      2460
     AFPCVVSRAY IYKSNFGKME YEVESVKCIG HLENAQAHVI KQFYYCNIKL VLRNKIIRNI      2520
     NVKAKGVSVL YTFHIQIENE DLKNFYIFMI PLDKDKQILG QAKPTDFFIK YV              2572
//

If you have problems or comments...

PBIL Back to PBIL home page