(data stored in SCRATCH zone)

EMBL: AL844507.PE64

AL844507.PE64        Location/Qualifiers
FT   CDS             complement(363260..366421)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806800"
FT                   /product="V-type proton ATPase subunit a, putative"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0113:mRNA"
FT                   /db_xref="GOA:Q8IAQ8"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAQ8"
FT                   /protein_id="CAD51303.1"
FT                   /translation="MGIFRSEIMKHGTLVLPSDRAREYLDCLGKEVDIQFIDMNEKTMK
FT                   RQYKKYIQRIDDMERILRFLEENINKLPNVKIKKSKIDNFLEHDNIYELDQVEESLNRL
FT                   HVQFVRFCNNNKDLIDEKNNAIEEKHVILTALNQLSPGFIRGVGGLRGSVIGGDQQQQH
FT                   HHNNNNNNNIVSPFDEGIEENNISLSTHIMKDGINMMFTNISGVIKTKDQESFSRTIFR
FT                   AFRGNTYTYFQNIDEDADDNDLLKNVEELESLKSAGDTNNMYKNNKQHDTFSDKLDGKD
FT                   KNDKKKKKDLKSVFVVYCQGSAQSNIYDKIMKICKAYDVKTYDWPRTYEHAKKRLKELR
FT                   EIINDKEKALKAYEEYFINEIFVLINVVEPNKNSLIEEWKLFCKKERHIYNNLNYFEGS
FT                   DITLRCDCWYSANDEEKIRHILINKSSNDLVSALLLSDKILRPNVSPPTYIKTNEFTKS
FT                   YQSMVDTYGVPRYGEINPAISTIITFPFLFGIMYGDVGHGLCIFLFALFLIIMNNKVKN
FT                   KKNNNEMVTMLFDGRYMLLLMGFFAVYAGFLYNDFFSMPLNLFSSMFMLDKQVDNMEYY
FT                   KRREITDSATGEVQYAYPYIFGFDCKWLGAENELTYINSFKMKFSIIIGFIHMTFGVLM
FT                   KGFNALHFKRKMDFFFEFLPQLVMMLSMIGYLVFLIIYKWVTPVGYGGFQKQGIINTII
FT                   NMYLMKEINSTNQFYPYQSIIQILLLSLFVLCIPFMFICKPAIRTYHIMKEKQKINDHN
FT                   VHKKNRRGKKAMAKRNNNNNNNNNNQNDNKNMLLTNQNFNEAGAKEMINAFHHNAKTGG
FT                   ILLSTNSKKKIVTSDGNHNNNLLSMHKRNTMNNKISSSPYHNEQPDDVYDQYDEYDDDD
FT                   DDDNYDENEYLNKKKKKRTDDDIEAHLLSSTYEEKGLQSSSAAMRGGGAGEENHHEENI
FT                   SEIWIEQLIETIEFILGLISNTASYLRLWALSLAHQQLSFVFFEQTILNSLKRNSFMSV
FT                   LINLILFSQLFSILTIAVILCMDTLECFLHSLRLQWVEFQNKFYKGDGIPFKPFNIKKL
FT                   LNENE"
     MGIFRSEIMK HGTLVLPSDR AREYLDCLGK EVDIQFIDMN EKTMKRQYKK YIQRIDDMER        60
     ILRFLEENIN KLPNVKIKKS KIDNFLEHDN IYELDQVEES LNRLHVQFVR FCNNNKDLID       120
     EKNNAIEEKH VILTALNQLS PGFIRGVGGL RGSVIGGDQQ QQHHHNNNNN NNIVSPFDEG       180
     IEENNISLST HIMKDGINMM FTNISGVIKT KDQESFSRTI FRAFRGNTYT YFQNIDEDAD       240
     DNDLLKNVEE LESLKSAGDT NNMYKNNKQH DTFSDKLDGK DKNDKKKKKD LKSVFVVYCQ       300
     GSAQSNIYDK IMKICKAYDV KTYDWPRTYE HAKKRLKELR EIINDKEKAL KAYEEYFINE       360
     IFVLINVVEP NKNSLIEEWK LFCKKERHIY NNLNYFEGSD ITLRCDCWYS ANDEEKIRHI       420
     LINKSSNDLV SALLLSDKIL RPNVSPPTYI KTNEFTKSYQ SMVDTYGVPR YGEINPAIST       480
     IITFPFLFGI MYGDVGHGLC IFLFALFLII MNNKVKNKKN NNEMVTMLFD GRYMLLLMGF       540
     FAVYAGFLYN DFFSMPLNLF SSMFMLDKQV DNMEYYKRRE ITDSATGEVQ YAYPYIFGFD       600
     CKWLGAENEL TYINSFKMKF SIIIGFIHMT FGVLMKGFNA LHFKRKMDFF FEFLPQLVMM       660
     LSMIGYLVFL IIYKWVTPVG YGGFQKQGII NTIINMYLMK EINSTNQFYP YQSIIQILLL       720
     SLFVLCIPFM FICKPAIRTY HIMKEKQKIN DHNVHKKNRR GKKAMAKRNN NNNNNNNNQN       780
     DNKNMLLTNQ NFNEAGAKEM INAFHHNAKT GGILLSTNSK KKIVTSDGNH NNNLLSMHKR       840
     NTMNNKISSS PYHNEQPDDV YDQYDEYDDD DDDDNYDENE YLNKKKKKRT DDDIEAHLLS       900
     STYEEKGLQS SSAAMRGGGA GEENHHEENI SEIWIEQLIE TIEFILGLIS NTASYLRLWA       960
     LSLAHQQLSF VFFEQTILNS LKRNSFMSVL INLILFSQLF SILTIAVILC MDTLECFLHS      1020
     LRLQWVEFQN KFYKGDGIPF KPFNIKKLLN ENE                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page