(data stored in ACNUC9543 zone)

EMBL: AL844507.PE65

AL844507.PE65        Location/Qualifiers
FT   CDS             complement(368607..369746)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806900"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806900"
FT                   /db_xref="GOA:A0A143ZWH7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZWH7"
FT                   /protein_id="CZT62751.1"
FT                   /translation="MRQGLCKRLVLLVSLNILIFIMVNYNFCSFGFIINRNEVMKGSSI
FT                   IIDNMKKKQSREKRKNIGFVNCFILRNNKIRWGKKEENNKKINIKRIFLFDRSVDKVSG
FT                   HFLQDRGLFIEADKKMKIIEEIEKMTKLEYKNVEKYLNVLSENDVYEEVINHKFYMYKK
FT                   NNEKEKHDRLIKIQEFLNPFIINLRKKKAKEKVEYLIACIIKGVNIDEVITEMFKRKMI
FT                   DIYVLTFIDDKIMEAHTKLLKDDKLNNKDEQMSISEKILRTLKDRIIAQQKLNKKGTFV
FT                   FTRLLFLSSTLDINEDRKSMIKSMINTIEQLEEFELYLLDALEYAHENDKLQKYIPHME
FT                   LLLNACKQVNPVYNQTLNKQSENIGFFPESVDPSNLKNF"
     MRQGLCKRLV LLVSLNILIF IMVNYNFCSF GFIINRNEVM KGSSIIIDNM KKKQSREKRK        60
     NIGFVNCFIL RNNKIRWGKK EENNKKINIK RIFLFDRSVD KVSGHFLQDR GLFIEADKKM       120
     KIIEEIEKMT KLEYKNVEKY LNVLSENDVY EEVINHKFYM YKKNNEKEKH DRLIKIQEFL       180
     NPFIINLRKK KAKEKVEYLI ACIIKGVNID EVITEMFKRK MIDIYVLTFI DDKIMEAHTK       240
     LLKDDKLNNK DEQMSISEKI LRTLKDRIIA QQKLNKKGTF VFTRLLFLSS TLDINEDRKS       300
     MIKSMINTIE QLEEFELYLL DALEYAHEND KLQKYIPHME LLLNACKQVN PVYNQTLNKQ       360
     SENIGFFPES VDPSNLKNF                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page