(data stored in ACNUC9543 zone)

EMBL: AL844507.PE66

AL844507.PE66        Location/Qualifiers
FT   CDS             join(370784,370911..370987,371150..371282,371493..371611,
FT                   371735..371785,371920..372022,372137..372252,
FT                   372424..372454,372586..372623)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0807000"
FT                   /product="YEATS domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0807000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.131:mRNA"
FT                   /db_xref="GOA:C0H4S5"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="InterPro:IPR038704"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4S5"
FT                   /protein_id="CAX64101.2"
FT                   /translation="MENRMQNVKLIKPLVVGTYAFLLSPQEKKKYGNMTHKWTCLVRCP
FT                   ESTDISLIVSKVVFELDPSFMYPKRVYTQPPYEVNEIGWGEFYLQVKIHFVDLTLSPIS
FT                   IVHFVKLNTDSDPNNIPPCVVNETYEEIIFKNPTVHFYNKFLQCNNTKIAPHKFQEHFI
FT                   KYDFKEDSYTKKYLQFQSEVQQEICDLMSEATLLSKDINDVQQKYFTMKSEMGVSSDEN
FT                   "
     MENRMQNVKL IKPLVVGTYA FLLSPQEKKK YGNMTHKWTC LVRCPESTDI SLIVSKVVFE        60
     LDPSFMYPKR VYTQPPYEVN EIGWGEFYLQ VKIHFVDLTL SPISIVHFVK LNTDSDPNNI       120
     PPCVVNETYE EIIFKNPTVH FYNKFLQCNN TKIAPHKFQE HFIKYDFKED SYTKKYLQFQ       180
     SEVQQEICDL MSEATLLSKD INDVQQKYFT MKSEMGVSSD EN                          222
//

If you have problems or comments...

PBIL Back to PBIL home page