(data stored in ACNUC9543 zone)

EMBL: AL844507.PE69

AL844507.PE69        Location/Qualifiers
FT   CDS             join(381564..381627,381863..381928,382159..382297,
FT                   382511..382847)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0807300"
FT                   /product="ras-related protein Rab-18"
FT                   /EC_number="3.6.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0807300"
FT                   /db_xref="GOA:Q7K6B0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7K6B0"
FT                   /protein_id="CAD51298.1"
FT                   /translation="MKNKNKYDYLLKLLLVGDSSVGKSSILCRYSDNQFEEKVLSTIGI
FT                   DFKVKYLKIDNKTIKVGIWDTAGQERFRTLTSAYYRNAHAIILVYDCTVRESFENLDVW
FT                   INEIDKYSTNKNAIKMLVANKIDKPNHEVTKDEGKNFAFENNMLFCETSAKNDINITYC
FT                   FEELIQQILNNPSLLELSIVTKNLKLGKKEESRSNCAC"
     MKNKNKYDYL LKLLLVGDSS VGKSSILCRY SDNQFEEKVL STIGIDFKVK YLKIDNKTIK        60
     VGIWDTAGQE RFRTLTSAYY RNAHAIILVY DCTVRESFEN LDVWINEIDK YSTNKNAIKM       120
     LVANKIDKPN HEVTKDEGKN FAFENNMLFC ETSAKNDINI TYCFEELIQQ ILNNPSLLEL       180
     SIVTKNLKLG KKEESRSNCA C                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page