(data stored in ACNUC9543 zone)

EMBL: AL844507.PE7

AL844507.PE7         Location/Qualifiers
FT   CDS             complement(join(65716..70434,70567..70832,70993..71785))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0800700"
FT                   /product="surface-associated interspersed protein 8.3
FT                   (SURFIN 8.3)"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0800700"
FT                   /db_xref="GOA:A0A143ZWG8"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZWG8"
FT                   /protein_id="CZT62741.1"
FT                   /translation="MAVEMNTPVSKKGVSSTAYSIYFSVFLKRLKSYVSDRISRIKNAT
FT                   DYEKPCRDLNYEIDEVKDLFCTRYLLNIPRYVRLASWNKNIEDHLKATMVSDSNQKCKR
FT                   SYPFYPRIQRYRRKLLADYCEERDKRRDVLNSSNDKDKCLEFNEWVIMSDNAINDSFNN
FT                   KITEGDRNKGAYTISNRCSLRKPHLLFPLLECHEEKKKEEEPEKKSDSDDEDLNKPKIP
FT                   EQDHKNVIPGIIGFSNSPSYVGFNPVHAESGMFRHSSPGLTFDKLNIFFDSPIFGHSKI
FT                   TGTAEGFGNIFNMHIEPKDVAIPFDTSPPVSIPASNVTVGSNTPVKITPYLMFTPAVLI
FT                   IVFISIILNLMNKKKPMIPVKIKEKIKVKSAVPSAEHIRIEELEKLREEMREKELEKLR
FT                   KKIHVPKKVEIIEEPYKIKLLERKKWLWKTIIEIHMLILEEQRKAEWEFNKADFLHICI
FT                   DEFSNQEKKSDINVIRSDLLFDEPEVIENIHMMNKQSDIWYRWVERNAHMLEKWKEEKW
FT                   FLRLKESWRDEEEEYMKRAYKELLISLRGDKYYMSQRQKIIWRKWIAKHTIRVREFVID
FT                   KWFNQLFEELEKEGIISDEAIRNFLSQHKEAYDEEKIEAFIKYKKKLLVVILWIKIYMS
FT                   VLEEYVKEEDIESEKLFIDTSLEELKKKKEIEEEVIEDLKKDIYEIDEKKEIEKYKGED
FT                   WFKQMQQDWIRRDYKFVSSYNLESDDEKEFHEFVKKPTMEIQKDLLKEQWKNIELKWIE
FT                   EDNYDAYLLEDKLLKKTEYIKPRDKMKHRIIKEDDIYSEQLKVFDEIEKRSIYLSSKRV
FT                   LKWKTIIEIHLEVLHDCKKEEWDNNKGDFLNICIEELVKGQNEDKKNKENYNYITNESD
FT                   NYDIVEYTKSFCNTWTDRHNYMLEKWNKENWFVQLKNDWKKEQNEYMRKTYKELLISLK
FT                   GDKYNMSQRQKIIWKKWIAKHPNKMNEEIINIWSNQLSDEIDKNGIISDEAIKNFLSLE
FT                   KDISDKDLLKCRKKKLEVILWVKIYMSVLEEQKNEELEKSKESFLNTCIDELKKEEYSE
FT                   ENERMITIVDEMKKGFRICDKVEDYKKKKKWKNEEWYKDLKKEWIKEEDKYKDAMDIME
FT                   KDEIYEDDLLNKSIVELEKSVSLKHWKDMYIKWIDEDNERDWLRIAIDKKNLKTDEINE
FT                   DINRMIELNMLEDYSNDLYDKKKIKWKTIIEIHMEVLNDCKNDEWEMNKGDFLDICLEE
FT                   FGTMENREYSHIINNMLMVGELEYKHLNMDVIERQNDLWNKWIEGHRYMLEKWKKEKWF
FT                   IVLKENWKNEEHKYMRKAYLELLMSLREDVKNPMLQRQKIIWRKWIAKNLYHIESNVMK
FT                   KWFDKLLEEILRKGAIEEDECINLIEMEENEEYLEELKEYRKKKLICIIWIKIYMMIIE
FT                   EHKKEEYLESKEIFLDTCVDELKEQEILEGNELYMDDMKKSILLSDQKEEIEKLKMKNW
FT                   YKDLKKEWMSEEDRYFRSIINEENDEEYKNMISRPLRDIEKKISKKHWDDIQLKWIDED
FT                   NERDWLKIARNENDEDNYAYEYVRNRRKKYMDVYSGYYKRNRRKSGDKISGNEISGNEI
FT                   SGNEISGNKISGKINKINTEKEILNYDIIKEDNNNNDYMNNYMYYNDMENTYEQGSDYR
FT                   RKDEYFDICFDLLKKGNMYYTNLWIENKKMDDSYEYLDKVLNKMLEKHKFLLYNVKERN
FT                   KELIDEWEREEWFINLWNDWNEERNNHMKSIMPYKYNITNFVEEEKKIWKEWISKIINS
FT                   VEEWEHEYWFNDLLERYEMYAIDFSDEIYSIELENYLKDKILKIALLMDIFMAILDTSF
FT                   YEESEENNEYFTKSEMEHMEYDKIYDLNDEEEKIKIRKWFEKCITETQNGEIAKKNKMR
FT                   KGSFQKELEEKGIMSENLEGETSVYNKQMIKQKMNILKESYSRNEGNKSTL"
     MAVEMNTPVS KKGVSSTAYS IYFSVFLKRL KSYVSDRISR IKNATDYEKP CRDLNYEIDE        60
     VKDLFCTRYL LNIPRYVRLA SWNKNIEDHL KATMVSDSNQ KCKRSYPFYP RIQRYRRKLL       120
     ADYCEERDKR RDVLNSSNDK DKCLEFNEWV IMSDNAINDS FNNKITEGDR NKGAYTISNR       180
     CSLRKPHLLF PLLECHEEKK KEEEPEKKSD SDDEDLNKPK IPEQDHKNVI PGIIGFSNSP       240
     SYVGFNPVHA ESGMFRHSSP GLTFDKLNIF FDSPIFGHSK ITGTAEGFGN IFNMHIEPKD       300
     VAIPFDTSPP VSIPASNVTV GSNTPVKITP YLMFTPAVLI IVFISIILNL MNKKKPMIPV       360
     KIKEKIKVKS AVPSAEHIRI EELEKLREEM REKELEKLRK KIHVPKKVEI IEEPYKIKLL       420
     ERKKWLWKTI IEIHMLILEE QRKAEWEFNK ADFLHICIDE FSNQEKKSDI NVIRSDLLFD       480
     EPEVIENIHM MNKQSDIWYR WVERNAHMLE KWKEEKWFLR LKESWRDEEE EYMKRAYKEL       540
     LISLRGDKYY MSQRQKIIWR KWIAKHTIRV REFVIDKWFN QLFEELEKEG IISDEAIRNF       600
     LSQHKEAYDE EKIEAFIKYK KKLLVVILWI KIYMSVLEEY VKEEDIESEK LFIDTSLEEL       660
     KKKKEIEEEV IEDLKKDIYE IDEKKEIEKY KGEDWFKQMQ QDWIRRDYKF VSSYNLESDD       720
     EKEFHEFVKK PTMEIQKDLL KEQWKNIELK WIEEDNYDAY LLEDKLLKKT EYIKPRDKMK       780
     HRIIKEDDIY SEQLKVFDEI EKRSIYLSSK RVLKWKTIIE IHLEVLHDCK KEEWDNNKGD       840
     FLNICIEELV KGQNEDKKNK ENYNYITNES DNYDIVEYTK SFCNTWTDRH NYMLEKWNKE       900
     NWFVQLKNDW KKEQNEYMRK TYKELLISLK GDKYNMSQRQ KIIWKKWIAK HPNKMNEEII       960
     NIWSNQLSDE IDKNGIISDE AIKNFLSLEK DISDKDLLKC RKKKLEVILW VKIYMSVLEE      1020
     QKNEELEKSK ESFLNTCIDE LKKEEYSEEN ERMITIVDEM KKGFRICDKV EDYKKKKKWK      1080
     NEEWYKDLKK EWIKEEDKYK DAMDIMEKDE IYEDDLLNKS IVELEKSVSL KHWKDMYIKW      1140
     IDEDNERDWL RIAIDKKNLK TDEINEDINR MIELNMLEDY SNDLYDKKKI KWKTIIEIHM      1200
     EVLNDCKNDE WEMNKGDFLD ICLEEFGTME NREYSHIINN MLMVGELEYK HLNMDVIERQ      1260
     NDLWNKWIEG HRYMLEKWKK EKWFIVLKEN WKNEEHKYMR KAYLELLMSL REDVKNPMLQ      1320
     RQKIIWRKWI AKNLYHIESN VMKKWFDKLL EEILRKGAIE EDECINLIEM EENEEYLEEL      1380
     KEYRKKKLIC IIWIKIYMMI IEEHKKEEYL ESKEIFLDTC VDELKEQEIL EGNELYMDDM      1440
     KKSILLSDQK EEIEKLKMKN WYKDLKKEWM SEEDRYFRSI INEENDEEYK NMISRPLRDI      1500
     EKKISKKHWD DIQLKWIDED NERDWLKIAR NENDEDNYAY EYVRNRRKKY MDVYSGYYKR      1560
     NRRKSGDKIS GNEISGNEIS GNEISGNKIS GKINKINTEK EILNYDIIKE DNNNNDYMNN      1620
     YMYYNDMENT YEQGSDYRRK DEYFDICFDL LKKGNMYYTN LWIENKKMDD SYEYLDKVLN      1680
     KMLEKHKFLL YNVKERNKEL IDEWEREEWF INLWNDWNEE RNNHMKSIMP YKYNITNFVE      1740
     EEKKIWKEWI SKIINSVEEW EHEYWFNDLL ERYEMYAIDF SDEIYSIELE NYLKDKILKI      1800
     ALLMDIFMAI LDTSFYEESE ENNEYFTKSE MEHMEYDKIY DLNDEEEKIK IRKWFEKCIT      1860
     ETQNGEIAKK NKMRKGSFQK ELEEKGIMSE NLEGETSVYN KQMIKQKMNI LKESYSRNEG      1920
     NKSTL                                                                  1925
//

If you have problems or comments...

PBIL Back to PBIL home page