(data stored in SCRATCH zone)

EMBL: AL844507.PE70

AL844507.PE70        Location/Qualifiers
FT   CDS             join(384298..384516,384954..385073,385254..385289,
FT                   385434..385499,385663..385797)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0807400"
FT                   /product="coenzyme Q-binding protein COQ10 homolog,
FT                   mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0807400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.300:mRNA"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4S7"
FT                   /protein_id="CAX64103.1"
FT                   /translation="MKINILKKGKKFYITNNHFNYDIKRNFTIFQNSFIKTNDIVYRKN
FT                   IDIVCAKDLFFYTILNVDRYKYFLPYVTDSKITEKNKEYFKANLQIENIFFKEKYDSLI
FT                   QFIYPTTITVSSEDTNIFHHLITEWIIKEKKNCINIDFYINFRLKNKIYQNFMNLYIKE
FT                   LGKKILYSFINESKSNSYKNTDVLHLIK"
     MKINILKKGK KFYITNNHFN YDIKRNFTIF QNSFIKTNDI VYRKNIDIVC AKDLFFYTIL        60
     NVDRYKYFLP YVTDSKITEK NKEYFKANLQ IENIFFKEKY DSLIQFIYPT TITVSSEDTN       120
     IFHHLITEWI IKEKKNCINI DFYINFRLKN KIYQNFMNLY IKELGKKILY SFINESKSNS       180
     YKNTDVLHLI K                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page