(data stored in ACNUC9543 zone)

EMBL: AL844507.PE72

AL844507.PE72        Location/Qualifiers
FT   CDS             complement(join(389596..389631,389766..393181,
FT                   393583..393831,393956..394259))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0807600"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0807600"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4S8"
FT                   /protein_id="CAX64104.1"
FT                   /translation="MKNMNDENGSTIEGDPNTEKAKNKNNNNNDDINENIIDDEKKKKE
FT                   QQQDDEEDEEDDEDDDEEDDADNDLCDQNVLIIGDENLSFSNYIIEAYASSNIYIASTL
FT                   TEFQVNLLLKDLEKKKVNKCLHEKREIDDVSTNYGPFDFTRKFKERHVSKNVHIIFNVN
FT                   LFNLKSYFPKNFFKAVFLILPGLSFNINDIQLKYNDKVTTLRIYYFLILVTLEITYISM
FT                   KNSNIHLFWTSEKLKNFVENEEEEENNKNEPDDTNDLTQNDISLNDNEIYSHGNDGFKK
FT                   ESIHDTINSLKNLMFNNVEHDHDDNMDSNADHNMDSNADHNMDSNADHNMDSNADHNMD
FT                   SNEDHNMDSNTDHNIDSNTDHNMDSNADHNMDSNTDHNMDNVDGTINYEEDNNLNGQDE
FT                   YYEENEEGDYTNEKDVNLINSSDINLEDNNEDISNHDKEKDNNNKKDDDDNKKDDDNKI
FT                   DDDNKIDDDDNKIDDDNKIDDDDNKIDDDDNKIDDDDNKIDDDDNKKDDDDNKKDDDNK
FT                   IDDDNKKDDDDNKKDDNNYDNNDECDDDNKKDDNNYDNNNFIYDDDAINNNNNFIYDDA
FT                   INNNNFISDDAINNNNNFIYDDESNGDYSDDNPEEETEKYSQDEENNIRDIFEDSYNKD
FT                   NEINELLDDVNTSTFEDIEIIKYIYTNDDLKNKKSGLINIIRFPLLYEINLKKLMKIFC
FT                   FYEHIKKEEKINTIFHIEDIINSYYPLVYGHHFMYNEFLKNCKFFSFVLKKKKKITIPE
FT                   ELVVLIPHIEYNYKIDSYHFLKKLYYSVFNEPRICYTSINEQIKHINQMRYKLYVHNLK
FT                   TSKHFKNEKISSIHNNMISSYYIYQNHINNMIKNKTTCCINDDLWKTVLNPFDFFHLNN
FT                   DVNVFFEYNILTNIYNKFVTTVNTDFNKLCVNFYIKKDYKQYEEDNTNEHNSKRIMKRK
FT                   FNKNGLYNTIGDNKNKPPLLPTPKNESYKLVNSINNNHRHNINNMNNQRNGNRHKNNTN
FT                   NNTLLYKHATNNIQNNFNKSYRNENNIRNSMHNNNYDNNTKREDKNQKYVKNENQREGT
FT                   SRKNNASSVYRNYNVSNGNEHTNFNNNVSASHANFSYKPMRNNNNNNNNNMRGDNNSMR
FT                   GGYSMRNDQRNDQRNDQRNDQRNDHRNDHRNDHRNDHRNDHRNDHRNDHRNDHRNDHRN
FT                   DQRNDHRNSMRNDHRNSMRNDHRNSMRNDQRNSMMNDQRNSMMNDQRNSMMNDQRNVKR
FT                   RREESHEMNRRGDIYSNKRYDKRGRIDYDMKLKMDEKKNEKNIKNHSEMQDPYASTKDT
FT                   SRNFDMNNFTISSERKSWKLPPPPPNIPPSYDRSSQRRTSNFYNNDDSSM"
     MKNMNDENGS TIEGDPNTEK AKNKNNNNND DINENIIDDE KKKKEQQQDD EEDEEDDEDD        60
     DEEDDADNDL CDQNVLIIGD ENLSFSNYII EAYASSNIYI ASTLTEFQVN LLLKDLEKKK       120
     VNKCLHEKRE IDDVSTNYGP FDFTRKFKER HVSKNVHIIF NVNLFNLKSY FPKNFFKAVF       180
     LILPGLSFNI NDIQLKYNDK VTTLRIYYFL ILVTLEITYI SMKNSNIHLF WTSEKLKNFV       240
     ENEEEEENNK NEPDDTNDLT QNDISLNDNE IYSHGNDGFK KESIHDTINS LKNLMFNNVE       300
     HDHDDNMDSN ADHNMDSNAD HNMDSNADHN MDSNADHNMD SNEDHNMDSN TDHNIDSNTD       360
     HNMDSNADHN MDSNTDHNMD NVDGTINYEE DNNLNGQDEY YEENEEGDYT NEKDVNLINS       420
     SDINLEDNNE DISNHDKEKD NNNKKDDDDN KKDDDNKIDD DNKIDDDDNK IDDDNKIDDD       480
     DNKIDDDDNK IDDDDNKIDD DDNKKDDDDN KKDDDNKIDD DNKKDDDDNK KDDNNYDNND       540
     ECDDDNKKDD NNYDNNNFIY DDDAINNNNN FIYDDAINNN NFISDDAINN NNNFIYDDES       600
     NGDYSDDNPE EETEKYSQDE ENNIRDIFED SYNKDNEINE LLDDVNTSTF EDIEIIKYIY       660
     TNDDLKNKKS GLINIIRFPL LYEINLKKLM KIFCFYEHIK KEEKINTIFH IEDIINSYYP       720
     LVYGHHFMYN EFLKNCKFFS FVLKKKKKIT IPEELVVLIP HIEYNYKIDS YHFLKKLYYS       780
     VFNEPRICYT SINEQIKHIN QMRYKLYVHN LKTSKHFKNE KISSIHNNMI SSYYIYQNHI       840
     NNMIKNKTTC CINDDLWKTV LNPFDFFHLN NDVNVFFEYN ILTNIYNKFV TTVNTDFNKL       900
     CVNFYIKKDY KQYEEDNTNE HNSKRIMKRK FNKNGLYNTI GDNKNKPPLL PTPKNESYKL       960
     VNSINNNHRH NINNMNNQRN GNRHKNNTNN NTLLYKHATN NIQNNFNKSY RNENNIRNSM      1020
     HNNNYDNNTK REDKNQKYVK NENQREGTSR KNNASSVYRN YNVSNGNEHT NFNNNVSASH      1080
     ANFSYKPMRN NNNNNNNNMR GDNNSMRGGY SMRNDQRNDQ RNDQRNDQRN DHRNDHRNDH      1140
     RNDHRNDHRN DHRNDHRNDH RNDHRNDQRN DHRNSMRNDH RNSMRNDHRN SMRNDQRNSM      1200
     MNDQRNSMMN DQRNSMMNDQ RNVKRRREES HEMNRRGDIY SNKRYDKRGR IDYDMKLKMD      1260
     EKKNEKNIKN HSEMQDPYAS TKDTSRNFDM NNFTISSERK SWKLPPPPPN IPPSYDRSSQ      1320
     RRTSNFYNND DSSM                                                        1334
//

If you have problems or comments...

PBIL Back to PBIL home page