(data stored in ACNUC9543 zone)

EMBL: AL844507.PE74

AL844507.PE74        Location/Qualifiers
FT   CDS             complement(join(399591..400946,401271..401360))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0807800"
FT                   /product="26S proteasome regulatory subunit RPN10,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0807800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0109:mRNA"
FT                   /db_xref="GOA:Q8IAR6"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR014624"
FT                   /db_xref="InterPro:IPR027040"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAR6"
FT                   /protein_id="CAD51294.1"
FT                   /translation="MSNIEATIICIDNSDYNRNEDIVPNRFLSQIDCVNVLCCNKTSLH
FT                   YKNNIGILMMAGDKIKVKVSLTNDIGQLLSCIHDIKLDGTCDIIRSLLIAQLALKHRVD
FT                   KNLDQKIILFIGSPFHVNEKQLINTGKQLKKNNISVDIISFGNIDKNRDKLMMLFESVN
FT                   NNDNCRFIECPEYENNLSKFVLNSFLNNNDFNIGNIQDDDQLLNAMQLSLEESQHMDKN
FT                   LNTTNNINTGSNHHTNNITTNNNDLPTIEEIENMKDIDNELKEALILSLREYTEKNKLE
FT                   NKDTTSNNNNNNNESNNNNNESNNNNNESNNNNNESNNNNNESNNNNNESNNNNNESNN
FT                   NNNGNTCGNNNNNSLNFYKKDDNFALVNESYKNNFDKNDENKLETSKEKKENESYEKVF
FT                   KIDKEENMEDTSKDIINEHIYKDIQHNDENNNVINQGEEKEQSASSLIQDPSYISNILG
FT                   KINPNVNVFDKKEGDSDKEKNKE"
     MSNIEATIIC IDNSDYNRNE DIVPNRFLSQ IDCVNVLCCN KTSLHYKNNI GILMMAGDKI        60
     KVKVSLTNDI GQLLSCIHDI KLDGTCDIIR SLLIAQLALK HRVDKNLDQK IILFIGSPFH       120
     VNEKQLINTG KQLKKNNISV DIISFGNIDK NRDKLMMLFE SVNNNDNCRF IECPEYENNL       180
     SKFVLNSFLN NNDFNIGNIQ DDDQLLNAMQ LSLEESQHMD KNLNTTNNIN TGSNHHTNNI       240
     TTNNNDLPTI EEIENMKDID NELKEALILS LREYTEKNKL ENKDTTSNNN NNNNESNNNN       300
     NESNNNNNES NNNNNESNNN NNESNNNNNE SNNNNNESNN NNNGNTCGNN NNNSLNFYKK       360
     DDNFALVNES YKNNFDKNDE NKLETSKEKK ENESYEKVFK IDKEENMEDT SKDIINEHIY       420
     KDIQHNDENN NVINQGEEKE QSASSLIQDP SYISNILGKI NPNVNVFDKK EGDSDKEKNK       480
     E                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page