(data stored in ACNUC9543 zone)

EMBL: AL844507.PE76

AL844507.PE76        Location/Qualifiers
FT   CDS             404996..409084
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0808000"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0808000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.124:mRNA"
FT                   /db_xref="GOA:C0H4S9"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4S9"
FT                   /protein_id="CAX64105.1"
FT                   /translation="MKISNYIFGRIIDCYSYVDKIKTHVEFNRIKKYFQDAHILDKYLN
FT                   NYKSKIEYYRGKIKENVHSILRNNYICFEKNVDEDLIFVNRYVYYEIKNEDCIMICRKR
FT                   LKRNFFKKKREYIGKKKDYIENKNIYDYYDYYDYYDYNSLEELKKRKYISRYTSEVVVI
FT                   FPSYFFIKHFKILRDFIFFFIIERNNSPLNFCYIFKGTFRIYDRYIKEKITKNKIPCIL
FT                   ENICNEQLVLKNQLNKKKRRNKKLTNIELYNDIHLNVEQNKNVHYNNMCCNYDIYKKYF
FT                   INKKNNMFRCSNFILPIINKCIFLKGGILNVEFLKFSKKDIFFFTTHINKKYRCNQLFL
FT                   NGPKCFKILIYEEKEEEYFLNLYKSKDNKKTFLLSGSHLHNKLFLLNLQKICSKKKNRI
FT                   KNNYIIKQRKHLIIDVVKLISCRLRGKCFLENFYEYIVIICQGEKNHVHIFSVSTKDIN
FT                   YLKKKRISRKKYNNAKYVNNKKYLKNQQKKNQQKKNHICLEKYDNNICSNNICSNNICS
FT                   NNICSNNICSNNICSNNICSNNIYNNYYYNIFHCDHTKYRINIRKIEIPIDSKIKKLAT
FT                   LKNCNLQDFDMTKYGLVLYLYKYFLTPFICIIDLKNIFIKTYKKRANVVINNIVQCTNN
FT                   NKFYKSNDLRKIMKIVYLPIKKGSISCGINNNFYSPFISFDICNTFINNIKLRLYLKKG
FT                   VLCLLKNINNIEDSDFVCSSSSSLFESTYFKYDKELQKIFELHKNFCIKDVFLKTKDNK
FT                   KIAITLVYKRKDNHHICYGDRNNITSMNMSRMDNINDCIKRIFDNSGSNYEEGNKNKEN
FT                   MEITNFFDYIKNEEKKINIDNNKTYCDNNKTYCDNNKMCCDNKKMFCDNNKMCCDNNKM
FT                   CCDKHNICCDKHNICCDNHNICCDNHNICCDKHNICCDKHNICCDKHNICCDNHNICCD
FT                   NFVNDPHSDKCSNNIFNDLPIIFDYNLLSEMNMESYENFNFVLNEKNNLLVPHFVYPSK
FT                   TIIHVYPFYNEMNLCTYNDEYYFYLLNNFVISYFHLRGSGGLMCHKDEEGVRKKYIDKS
FT                   KEKKKILDDFIQCINFLKYKNISNTENISLYLYSNCGMIGGYILSCIFKIVKNIIFVNP
FT                   LLDIFNNLSDRNNPHVPSEYLEFGSMNINDYNIKKNIHISINKKNTNQIHFVYKKHCNG
FT                   YYNNDFKRKRKYIKGRYLKGTNKIVRNNNNNNNNNKNKYNSIPYYIYSMCPYYNIYPNY
FT                   KEHFCNNSNNISKEVFSLNKDNTNIFFKSNILLYLNKYDIICSNYNSIKYFTKYIHYKN
FT                   LTINYFYYYDNDQNILDESHKQHNNKLNFINFKNNNEQNENANFYISFSDKGGHSGYDS
FT                   SSGYLNNMLDKIFLHFFIN"
     MKISNYIFGR IIDCYSYVDK IKTHVEFNRI KKYFQDAHIL DKYLNNYKSK IEYYRGKIKE        60
     NVHSILRNNY ICFEKNVDED LIFVNRYVYY EIKNEDCIMI CRKRLKRNFF KKKREYIGKK       120
     KDYIENKNIY DYYDYYDYYD YNSLEELKKR KYISRYTSEV VVIFPSYFFI KHFKILRDFI       180
     FFFIIERNNS PLNFCYIFKG TFRIYDRYIK EKITKNKIPC ILENICNEQL VLKNQLNKKK       240
     RRNKKLTNIE LYNDIHLNVE QNKNVHYNNM CCNYDIYKKY FINKKNNMFR CSNFILPIIN       300
     KCIFLKGGIL NVEFLKFSKK DIFFFTTHIN KKYRCNQLFL NGPKCFKILI YEEKEEEYFL       360
     NLYKSKDNKK TFLLSGSHLH NKLFLLNLQK ICSKKKNRIK NNYIIKQRKH LIIDVVKLIS       420
     CRLRGKCFLE NFYEYIVIIC QGEKNHVHIF SVSTKDINYL KKKRISRKKY NNAKYVNNKK       480
     YLKNQQKKNQ QKKNHICLEK YDNNICSNNI CSNNICSNNI CSNNICSNNI CSNNICSNNI       540
     YNNYYYNIFH CDHTKYRINI RKIEIPIDSK IKKLATLKNC NLQDFDMTKY GLVLYLYKYF       600
     LTPFICIIDL KNIFIKTYKK RANVVINNIV QCTNNNKFYK SNDLRKIMKI VYLPIKKGSI       660
     SCGINNNFYS PFISFDICNT FINNIKLRLY LKKGVLCLLK NINNIEDSDF VCSSSSSLFE       720
     STYFKYDKEL QKIFELHKNF CIKDVFLKTK DNKKIAITLV YKRKDNHHIC YGDRNNITSM       780
     NMSRMDNIND CIKRIFDNSG SNYEEGNKNK ENMEITNFFD YIKNEEKKIN IDNNKTYCDN       840
     NKTYCDNNKM CCDNKKMFCD NNKMCCDNNK MCCDKHNICC DKHNICCDNH NICCDNHNIC       900
     CDKHNICCDK HNICCDKHNI CCDNHNICCD NFVNDPHSDK CSNNIFNDLP IIFDYNLLSE       960
     MNMESYENFN FVLNEKNNLL VPHFVYPSKT IIHVYPFYNE MNLCTYNDEY YFYLLNNFVI      1020
     SYFHLRGSGG LMCHKDEEGV RKKYIDKSKE KKKILDDFIQ CINFLKYKNI SNTENISLYL      1080
     YSNCGMIGGY ILSCIFKIVK NIIFVNPLLD IFNNLSDRNN PHVPSEYLEF GSMNINDYNI      1140
     KKNIHISINK KNTNQIHFVY KKHCNGYYNN DFKRKRKYIK GRYLKGTNKI VRNNNNNNNN      1200
     NKNKYNSIPY YIYSMCPYYN IYPNYKEHFC NNSNNISKEV FSLNKDNTNI FFKSNILLYL      1260
     NKYDIICSNY NSIKYFTKYI HYKNLTINYF YYYDNDQNIL DESHKQHNNK LNFINFKNNN      1320
     EQNENANFYI SFSDKGGHSG YDSSSGYLNN MLDKIFLHFF IN                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page