(data stored in ACNUC9543 zone)

EMBL: AL844507.PE80

AL844507.PE80        Location/Qualifiers
FT   CDS             join(423527..423544,423718..424536)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0808400"
FT                   /product="coatomer subunit epsilon, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0808400"
FT                   /db_xref="GOA:C0H4T1"
FT                   /db_xref="InterPro:IPR006822"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4T1"
FT                   /protein_id="CAX64107.1"
FT                   /translation="MDTPLQIRDFFYGGFNKHCLSYFENVKDEKEKKECEEFIYQIYMM
FT                   ENIKKDAILKLKNEKNENLYLLYLYYKYYYMNDKENVLNEIKQLNTSSCNANILKSRIF
FT                   FDNDLLDECFDLLENGTIEIKAAKIFFLLNINRQDIVNEIIKDFLHMNEEIPIIKIVLA
FT                   IYYLFNDNNKESFLIFDDLESLYGSMINDHSNIILNGKAVASILNYEFNDAKEFLKNQI
FT                   NNGDILYNLITCSLYLYELDEANEYLTKLYDNYSSHDSLKVLKKIDDEVDNFVSEF"
     MDTPLQIRDF FYGGFNKHCL SYFENVKDEK EKKECEEFIY QIYMMENIKK DAILKLKNEK        60
     NENLYLLYLY YKYYYMNDKE NVLNEIKQLN TSSCNANILK SRIFFDNDLL DECFDLLENG       120
     TIEIKAAKIF FLLNINRQDI VNEIIKDFLH MNEEIPIIKI VLAIYYLFND NNKESFLIFD       180
     DLESLYGSMI NDHSNIILNG KAVASILNYE FNDAKEFLKN QINNGDILYN LITCSLYLYE       240
     LDEANEYLTK LYDNYSSHDS LKVLKKIDDE VDNFVSEF                               278
//

If you have problems or comments...

PBIL Back to PBIL home page