(data stored in ACNUC9543 zone)

EMBL: AL844507.PE81

AL844507.PE81        Location/Qualifiers
FT   CDS             complement(join(424794..424937,425043..425171))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0808450"
FT                   /product="protein MPODD, putative"
FT                   /protein_id="VWP74353.1"
FT                   /translation="MIKLPFYSFNKNSLLVQCLKSACVYYIPQNLLVLSAFIFYKYKKS
FT                   QFTNGKRIPITNCNEAIHNFVVEKKLKKDDIQIQKKKNVYIISLV"
     MIKLPFYSFN KNSLLVQCLK SACVYYIPQN LLVLSAFIFY KYKKSQFTNG KRIPITNCNE        60
     AIHNFVVEKK LKKDDIQIQK KKNVYIISLV                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page