(data stored in ACNUC9543 zone)

EMBL: AL844507.PE82

AL844507.PE82        Location/Qualifiers
FT   CDS             join(431165..436546,437636..439051)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0808600"
FT                   /product="erythrocyte membrane protein 1, PfEMP1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0808600"
FT                   /db_xref="GOA:Q8IAS3"
FT                   /db_xref="InterPro:IPR004258"
FT                   /db_xref="InterPro:IPR008602"
FT                   /db_xref="InterPro:IPR029210"
FT                   /db_xref="InterPro:IPR029211"
FT                   /db_xref="InterPro:IPR041480"
FT                   /db_xref="InterPro:IPR042202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAS3"
FT                   /protein_id="CAD51287.1"
FT                   /translation="MPPLGRQVGGSPQDDDAKNMFDRIGKDVYDQVKKGVAETYKEALT
FT                   GQLSLATLLGVESASTTDPCGLDYSKLISGSGVAARGHPCGNESVSEKRFSKERVDEYD
FT                   EKKIKDNKGNRGNNEGECAPYRRLSLCNKNFQKINNIDSDKARHNLLVDVCLAAHYEGD
FT                   SIKAHLEQYDATYPGSGSTTCTALARSFADIGDIVRGRDLYRGNKKKIKTETERDKLEQ
FT                   KLKEIFKNIKKENNEKLKSLTDDQIREYWWTANRHTVWKAITCKADASSAYFHATCSDS
FT                   HRSGTFSQANNYCRCNGDQPGNDKENIDPPTYFDYVPQYLRWFEEWAEDFCRKKKHKLN
FT                   DAIQKCRGEDKYGKDRYCDLNGYDCEKTKRGRNMYRWDHKCTGCFLSCSHFRTWIDNQK
FT                   LEFLKQKEKYTNEISGGKSRKKRAARSSSSSSYDNGYEKKFYDQLKAGGYNGVNSFLDL
FT                   LSKEKTCKDITDTEGGKIDFKNVNSDKNSYDDDSNKTFSHTEYCQACPLCGVKRNGRKW
FT                   ERKEVMKDCPPINLYKPKKDAEGTLINFLYSGDETNEIAKKLKAFCAQANGDTTNGTGG
FT                   NGTGGSVAGGTGTSGSNELYQKWKCYEIDELTKDQKEGGEDDPVYDEDVKTGGGLCILE
FT                   NKNKSKGSQSNSQKEPDEIQKTFNPFFYYWVVHMLKDSIHWRTKKLDKCINNSNESKAC
FT                   KNNNKCKDDCGCFLKWVVQKKTEWENIKKHFKKQKDIPPGFTHDDVLEGVLEKEVLLTS
FT                   IKEGYGNEKDIKHIKKLLDEEEAAGVTDNENKTTIDKLLKHEKDEADKCKQIQEECNKQ
FT                   KQQERGGPGGRSADPSPPADLDEHSSDEGEEDDDDDEEEENANEETAEDATEDTQVDGT
FT                   EVVEETVAEVTEVTEVKPCEIVQKLFTNGDLQNTFKDACEQKYGYPQRHWGWKCISDTT
FT                   TGKSGDNTGSSGAICIPPRRRKLYIGKIKEWANSGNTQAAEPQEDGKAQTPQGQTPSQS
FT                   GKESSQSQKLREAFIQSAAIETFFLWDRYKKVKNKEIAEKKQRDSTNPFGFTQSTSGGM
FT                   QALPVGGAVQGAQAQLPDGAGGSDQTPEKQLAGGKIPEVFLRQMFYTLGDYRDICVGNT
FT                   PSGIDTNDKENMQKIQNKIKSVIEKSDSTPRTPGTHSPSSGTTPQALWDKISPSIWEGM
FT                   LCALTYKDGGEGKKIEKVNDANGDDLFQKLKDKYSDYKTVTLEEDNTSSAMSTSPRTSE
FT                   TTSASSDNTPTLNNPKLSDFVLRPPYFRYLEEWGQNFCKKRTEMLEKIKEECRSGTGGH
FT                   EYCSGDGHDCTDNDRKYNKMIADFHCPGCAKECMKYKTWIGKKFEEFKKQENTYKVEHG
FT                   KLTNNNCSGSDNTKFCQQIKNNSFDKFLELLRHCKDGKDDTDKDNELNFSKPLQTFSRS
FT                   TYCKACPIYGVKYNRGTYSAINESEYMSKNGISGENKNDKKPTEIKVLLLGRKGEVRNN
FT                   DEELKELKEVCNNAGFVEDYSLQKWNCQKKNGVDQCNLTNSVDNIDDSDKIIPFNVFFQ
FT                   RWLRNFVHDYNKLKQKIHPCIKNEDGKEHKCIEGCKKKCECVEKWLDKKSTEWDEIKKH
FT                   YEKHSKDHNEGIPHSVKGYLVQAPFKDEVLKAIKPCDFDNFKTSCGLNGTDNSQNGNNN
FT                   DLVLCMIKNLEKKIEQCKKKHDENKKTPCDPLPPLPDENDETLEENPVAQPNICPQLPE
FT                   EPKETCEEAVTPSEPKKAEEEPAAEPEAVPEEEAPLPPPPPAAPPRESKEKAKPPPKPR
FT                   IKTRHVLDHPAVIPALMSSTIMWSIGIGFAAFTYFFLKKKTKSSVGNLFQILQIPKSNY
FT                   DIPTKRSPNRYIPYTSGKYRGKRYIYLEGDSGTDSGYTDHYSDITSSSESEYEEMDIND
FT                   IYAPRAPKYKTLIEVVLEPSGNNTTASGKNTPSDTQNDIPTSDTPPPITDDEWNTLKHD
FT                   FISQYLPNTQNTEPNILHDNLDNNTHPTPSRHTLDQKPFIMSIHDRDLYSGEEISYNIH
FT                   MSTNSMDDPKYVSNNVYSGIDLINDTLSGNKHIDIYDEVLKRKENELFGTNYKKNTSNN
FT                   SVTKNINSDPIDNQLNLFHTWLDRHRDMCEQWNNKEELLDKLKEEWENETHSGNKHSDI
FT                   PSGKLSDTPSDNNIHSDIHPSDIPSGKQSDIPSDNNIHSDIPYVLNTDVSIQIHMDNPK
FT                   TTNEFTYVDSNPNQVDDTYVDSNPDNSSMDTILDDLEKYNEPYYDVQDDIYYDVNDHDT
FT                   STVDSNAMDIPSKVQIEMDVNTKLVKEKYPIGDVWDI"
     MPPLGRQVGG SPQDDDAKNM FDRIGKDVYD QVKKGVAETY KEALTGQLSL ATLLGVESAS        60
     TTDPCGLDYS KLISGSGVAA RGHPCGNESV SEKRFSKERV DEYDEKKIKD NKGNRGNNEG       120
     ECAPYRRLSL CNKNFQKINN IDSDKARHNL LVDVCLAAHY EGDSIKAHLE QYDATYPGSG       180
     STTCTALARS FADIGDIVRG RDLYRGNKKK IKTETERDKL EQKLKEIFKN IKKENNEKLK       240
     SLTDDQIREY WWTANRHTVW KAITCKADAS SAYFHATCSD SHRSGTFSQA NNYCRCNGDQ       300
     PGNDKENIDP PTYFDYVPQY LRWFEEWAED FCRKKKHKLN DAIQKCRGED KYGKDRYCDL       360
     NGYDCEKTKR GRNMYRWDHK CTGCFLSCSH FRTWIDNQKL EFLKQKEKYT NEISGGKSRK       420
     KRAARSSSSS SYDNGYEKKF YDQLKAGGYN GVNSFLDLLS KEKTCKDITD TEGGKIDFKN       480
     VNSDKNSYDD DSNKTFSHTE YCQACPLCGV KRNGRKWERK EVMKDCPPIN LYKPKKDAEG       540
     TLINFLYSGD ETNEIAKKLK AFCAQANGDT TNGTGGNGTG GSVAGGTGTS GSNELYQKWK       600
     CYEIDELTKD QKEGGEDDPV YDEDVKTGGG LCILENKNKS KGSQSNSQKE PDEIQKTFNP       660
     FFYYWVVHML KDSIHWRTKK LDKCINNSNE SKACKNNNKC KDDCGCFLKW VVQKKTEWEN       720
     IKKHFKKQKD IPPGFTHDDV LEGVLEKEVL LTSIKEGYGN EKDIKHIKKL LDEEEAAGVT       780
     DNENKTTIDK LLKHEKDEAD KCKQIQEECN KQKQQERGGP GGRSADPSPP ADLDEHSSDE       840
     GEEDDDDDEE EENANEETAE DATEDTQVDG TEVVEETVAE VTEVTEVKPC EIVQKLFTNG       900
     DLQNTFKDAC EQKYGYPQRH WGWKCISDTT TGKSGDNTGS SGAICIPPRR RKLYIGKIKE       960
     WANSGNTQAA EPQEDGKAQT PQGQTPSQSG KESSQSQKLR EAFIQSAAIE TFFLWDRYKK      1020
     VKNKEIAEKK QRDSTNPFGF TQSTSGGMQA LPVGGAVQGA QAQLPDGAGG SDQTPEKQLA      1080
     GGKIPEVFLR QMFYTLGDYR DICVGNTPSG IDTNDKENMQ KIQNKIKSVI EKSDSTPRTP      1140
     GTHSPSSGTT PQALWDKISP SIWEGMLCAL TYKDGGEGKK IEKVNDANGD DLFQKLKDKY      1200
     SDYKTVTLEE DNTSSAMSTS PRTSETTSAS SDNTPTLNNP KLSDFVLRPP YFRYLEEWGQ      1260
     NFCKKRTEML EKIKEECRSG TGGHEYCSGD GHDCTDNDRK YNKMIADFHC PGCAKECMKY      1320
     KTWIGKKFEE FKKQENTYKV EHGKLTNNNC SGSDNTKFCQ QIKNNSFDKF LELLRHCKDG      1380
     KDDTDKDNEL NFSKPLQTFS RSTYCKACPI YGVKYNRGTY SAINESEYMS KNGISGENKN      1440
     DKKPTEIKVL LLGRKGEVRN NDEELKELKE VCNNAGFVED YSLQKWNCQK KNGVDQCNLT      1500
     NSVDNIDDSD KIIPFNVFFQ RWLRNFVHDY NKLKQKIHPC IKNEDGKEHK CIEGCKKKCE      1560
     CVEKWLDKKS TEWDEIKKHY EKHSKDHNEG IPHSVKGYLV QAPFKDEVLK AIKPCDFDNF      1620
     KTSCGLNGTD NSQNGNNNDL VLCMIKNLEK KIEQCKKKHD ENKKTPCDPL PPLPDENDET      1680
     LEENPVAQPN ICPQLPEEPK ETCEEAVTPS EPKKAEEEPA AEPEAVPEEE APLPPPPPAA      1740
     PPRESKEKAK PPPKPRIKTR HVLDHPAVIP ALMSSTIMWS IGIGFAAFTY FFLKKKTKSS      1800
     VGNLFQILQI PKSNYDIPTK RSPNRYIPYT SGKYRGKRYI YLEGDSGTDS GYTDHYSDIT      1860
     SSSESEYEEM DINDIYAPRA PKYKTLIEVV LEPSGNNTTA SGKNTPSDTQ NDIPTSDTPP      1920
     PITDDEWNTL KHDFISQYLP NTQNTEPNIL HDNLDNNTHP TPSRHTLDQK PFIMSIHDRD      1980
     LYSGEEISYN IHMSTNSMDD PKYVSNNVYS GIDLINDTLS GNKHIDIYDE VLKRKENELF      2040
     GTNYKKNTSN NSVTKNINSD PIDNQLNLFH TWLDRHRDMC EQWNNKEELL DKLKEEWENE      2100
     THSGNKHSDI PSGKLSDTPS DNNIHSDIHP SDIPSGKQSD IPSDNNIHSD IPYVLNTDVS      2160
     IQIHMDNPKT TNEFTYVDSN PNQVDDTYVD SNPDNSSMDT ILDDLEKYNE PYYDVQDDIY      2220
     YDVNDHDTST VDSNAMDIPS KVQIEMDVNT KLVKEKYPIG DVWDI                      2265
//

If you have problems or comments...

PBIL Back to PBIL home page