(data stored in ACNUC9543 zone)

EMBL: AL844507.PE83

AL844507.PE83        Location/Qualifiers
FT   CDS             join(440408..445771,446731..448062)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0808700"
FT                   /product="erythrocyte membrane protein 1, PfEMP1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0808700"
FT                   /db_xref="GOA:Q8IAS4"
FT                   /db_xref="InterPro:IPR004258"
FT                   /db_xref="InterPro:IPR008602"
FT                   /db_xref="InterPro:IPR029210"
FT                   /db_xref="InterPro:IPR029211"
FT                   /db_xref="InterPro:IPR041480"
FT                   /db_xref="InterPro:IPR042202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAS4"
FT                   /protein_id="CAD51286.1"
FT                   /translation="MAASTTYSSAPDAKHLLDMIGKDVHDQVKKEAKERSKGELTGQLS
FT                   FASILGERAYTTDPCQLIKEKRENLIGDRGERHPCGNGSGKGEDVNRFSKERVDEYDNK
FT                   KMKCSYGSNGKSEGACAPFRRLHVCDKNIQQIKTENITTHNLLLDVCLAAKYEGESLKG
FT                   YHEQYEVQYPSSGSTMCTELARSFADIGDIVRGRDLYGGSKKEKEKRKQLDDKLKKIFE
FT                   NIKKENNEKLKSLTDDQIREYWWTANRETVWKAITCDEENKLGGYLYFRGTCGDNEKSV
FT                   TQARDKCRCKKKDNTPDDQVPTYFDYVPQYLRWFEEWGEDFCRKKKKKVENAKKKCRGE
FT                   NNDKYCSRNGCDCEKTVRAKGKLRYGNRCTDCLYACYPYVHWIDKKKEEFDKQVKKYDE
FT                   EIKKYTKVASGSSRKTRAATIKYEGYEKKFYEKLKESDYGKVDKFLEKLSKDKECEKVD
FT                   DEEGGKINFAEKHDNNNNDEKEGTFYRSKYCQPCPYCGMKKKVPGKEWEKKNDNCTSGK
FT                   LYEPKGDAEGTPIKILKSGENHDDIKQKIDDFCKTEDDESLYAAWKCYKHDEVQKVKRE
FT                   GEEEDDDEEDYKNVKAAGGLCILENQKKKEEGKEKKSEKEPEQFQKTFNDFFTYWVAHM
FT                   LKDSIYWRTKKIKKCLENGKTMKCRNGCNNDCDCFESWVKQKKEKEWKPIKDHFGKQED
FT                   IKQETGMDPGDFLEYYLKLQFFEEVSEEKSQTGDEDANEKKRIKEMFDKKNQRTDKVAS
FT                   NEETIIDFMLEEELKDATKCKQDCEQRKPPGAGGGDVRSDTVPSRDPLTPGPTDGHEDS
FT                   EDEEEEEEEEDEEHGPDDKEGTEENVEETETVEDQVEEEKAKDNTDGKGEEEEDNQGET
FT                   TQITTQDGVNPCDIVDKLFKDDNTLTNACPTKYEKGREKFPNWKCIPSGDKTDTRERAG
FT                   RSRRDTSGENTTTGSSGDTNGSVCVPSRRRKLYIQKLHDWAEKQVGTTQVDGKAAQGDA
FT                   ASKDPKVELRNAFIQSAAVETFFLWHKYKAENTKTQGGVGSLPLQTIDRNSANGDDEDN
FT                   PEKQLKEGTIPHGFLRQMFYTLGDYRDILVGKYVDNGKDMEEVKSNIDSFFSNGEKPDD
FT                   KKGVEQRKEWWKENAKHIWHGMICALTYDTNTASGDKHTLKQNKSLKEALWDEQKKKPK
FT                   KTDNGSDYTYESVVLKEDDEGGGPRGQTSSPSSGEKTTLNNPKLSDFVLRPPYFRYLEE
FT                   WGQNFCKERKKRLEKIEEECMEYGSRGKQKQKYSGDGEECEKVLVEDANIFSDLSSSCA
FT                   TPCRKYRKWIERKKYEFTEQYNAYGGQKNNYVNEQKDKCQTQSNNHDNGFCGTLEKDAA
FT                   AFLNRLKNGPCKNNNDNGEEHKIDFNDTKKTFKHTEYCGPCSEFKVKCKNGACGDSNTQ
FT                   KKCNGITPIDGNEIAKMITSTEEVVMRVSDNSGNRFDGDLKEACNGKGIFKSIKENKWE
FT                   CRNVCGYVVCKPKEGNRETASGENKDQIITIRALVTHWVQNFLDDYKKIKHKISQCTKT
FT                   DQGSTCQNKCQNKCKCVGEWIPKKREEWEKIRKRFLEQYKIENDEDFNVRSCLENFLVQ
FT                   IGAANAKNKVIKLSKFGNSCGCSADASAQKNDGHKDAIDCLLQKLQNKIDDCNKNQAQN
FT                   SVETQPSDENPAQCQDTHPDDDLLLEEEQNPKNMRPGFCPEDDTTEQQEEEQDTCTPAG
FT                   TVKEEEEEKEEKKDKGDEEEESPSGNSAPDPPESPSAGPNHNQHPPAIPTPATPAADPP
FT                   QADEPFNRDILEKTIPFGVALALGSIAFLFLKKKTKSSVGNLFQILQIPKSDYDIPTLK
FT                   SKNRYIPYKSGPYKGKTYIYMEGDSDEDKYAFMSDTTDITSSESEYEEMDINDIYVPGS
FT                   PKYKTLIEVVLEPSGNNTTASGKNTPSDTQNDIQNDGIPSSKITDNEWNTLKHDFISNM
FT                   LQNEPNTEPNILHDNLDNNTHPTMSRDNMEEKPFITSIHDRNLYTGEEYNYNVNMVNSM
FT                   DDTKYVSNNVYSGIDLINDTLSGNKHIDIYDEVLKRKENELFGTNHVKQTSIHSVAKLT
FT                   NSDPIHKQLDLLHTWLDRHRHMCEKWNNKEELLDKLKKEWNKENNTNSSLTHTSNIPSG
FT                   ENSIKNVLNTDVSIQIDMDNPKPKNEFTNMDTIPDKSTMDTILDDLEKYNEPYYYDFYK
FT                   DDIYYDVNDDDKTSMDDIYVDHNNVTSNNMDVPTKMHIEMNIVNNKNEIFEEEYPISDI
FT                   WNI"
     MAASTTYSSA PDAKHLLDMI GKDVHDQVKK EAKERSKGEL TGQLSFASIL GERAYTTDPC        60
     QLIKEKRENL IGDRGERHPC GNGSGKGEDV NRFSKERVDE YDNKKMKCSY GSNGKSEGAC       120
     APFRRLHVCD KNIQQIKTEN ITTHNLLLDV CLAAKYEGES LKGYHEQYEV QYPSSGSTMC       180
     TELARSFADI GDIVRGRDLY GGSKKEKEKR KQLDDKLKKI FENIKKENNE KLKSLTDDQI       240
     REYWWTANRE TVWKAITCDE ENKLGGYLYF RGTCGDNEKS VTQARDKCRC KKKDNTPDDQ       300
     VPTYFDYVPQ YLRWFEEWGE DFCRKKKKKV ENAKKKCRGE NNDKYCSRNG CDCEKTVRAK       360
     GKLRYGNRCT DCLYACYPYV HWIDKKKEEF DKQVKKYDEE IKKYTKVASG SSRKTRAATI       420
     KYEGYEKKFY EKLKESDYGK VDKFLEKLSK DKECEKVDDE EGGKINFAEK HDNNNNDEKE       480
     GTFYRSKYCQ PCPYCGMKKK VPGKEWEKKN DNCTSGKLYE PKGDAEGTPI KILKSGENHD       540
     DIKQKIDDFC KTEDDESLYA AWKCYKHDEV QKVKREGEEE DDDEEDYKNV KAAGGLCILE       600
     NQKKKEEGKE KKSEKEPEQF QKTFNDFFTY WVAHMLKDSI YWRTKKIKKC LENGKTMKCR       660
     NGCNNDCDCF ESWVKQKKEK EWKPIKDHFG KQEDIKQETG MDPGDFLEYY LKLQFFEEVS       720
     EEKSQTGDED ANEKKRIKEM FDKKNQRTDK VASNEETIID FMLEEELKDA TKCKQDCEQR       780
     KPPGAGGGDV RSDTVPSRDP LTPGPTDGHE DSEDEEEEEE EEDEEHGPDD KEGTEENVEE       840
     TETVEDQVEE EKAKDNTDGK GEEEEDNQGE TTQITTQDGV NPCDIVDKLF KDDNTLTNAC       900
     PTKYEKGREK FPNWKCIPSG DKTDTRERAG RSRRDTSGEN TTTGSSGDTN GSVCVPSRRR       960
     KLYIQKLHDW AEKQVGTTQV DGKAAQGDAA SKDPKVELRN AFIQSAAVET FFLWHKYKAE      1020
     NTKTQGGVGS LPLQTIDRNS ANGDDEDNPE KQLKEGTIPH GFLRQMFYTL GDYRDILVGK      1080
     YVDNGKDMEE VKSNIDSFFS NGEKPDDKKG VEQRKEWWKE NAKHIWHGMI CALTYDTNTA      1140
     SGDKHTLKQN KSLKEALWDE QKKKPKKTDN GSDYTYESVV LKEDDEGGGP RGQTSSPSSG      1200
     EKTTLNNPKL SDFVLRPPYF RYLEEWGQNF CKERKKRLEK IEEECMEYGS RGKQKQKYSG      1260
     DGEECEKVLV EDANIFSDLS SSCATPCRKY RKWIERKKYE FTEQYNAYGG QKNNYVNEQK      1320
     DKCQTQSNNH DNGFCGTLEK DAAAFLNRLK NGPCKNNNDN GEEHKIDFND TKKTFKHTEY      1380
     CGPCSEFKVK CKNGACGDSN TQKKCNGITP IDGNEIAKMI TSTEEVVMRV SDNSGNRFDG      1440
     DLKEACNGKG IFKSIKENKW ECRNVCGYVV CKPKEGNRET ASGENKDQII TIRALVTHWV      1500
     QNFLDDYKKI KHKISQCTKT DQGSTCQNKC QNKCKCVGEW IPKKREEWEK IRKRFLEQYK      1560
     IENDEDFNVR SCLENFLVQI GAANAKNKVI KLSKFGNSCG CSADASAQKN DGHKDAIDCL      1620
     LQKLQNKIDD CNKNQAQNSV ETQPSDENPA QCQDTHPDDD LLLEEEQNPK NMRPGFCPED      1680
     DTTEQQEEEQ DTCTPAGTVK EEEEEKEEKK DKGDEEEESP SGNSAPDPPE SPSAGPNHNQ      1740
     HPPAIPTPAT PAADPPQADE PFNRDILEKT IPFGVALALG SIAFLFLKKK TKSSVGNLFQ      1800
     ILQIPKSDYD IPTLKSKNRY IPYKSGPYKG KTYIYMEGDS DEDKYAFMSD TTDITSSESE      1860
     YEEMDINDIY VPGSPKYKTL IEVVLEPSGN NTTASGKNTP SDTQNDIQND GIPSSKITDN      1920
     EWNTLKHDFI SNMLQNEPNT EPNILHDNLD NNTHPTMSRD NMEEKPFITS IHDRNLYTGE      1980
     EYNYNVNMVN SMDDTKYVSN NVYSGIDLIN DTLSGNKHID IYDEVLKRKE NELFGTNHVK      2040
     QTSIHSVAKL TNSDPIHKQL DLLHTWLDRH RHMCEKWNNK EELLDKLKKE WNKENNTNSS      2100
     LTHTSNIPSG ENSIKNVLNT DVSIQIDMDN PKPKNEFTNM DTIPDKSTMD TILDDLEKYN      2160
     EPYYYDFYKD DIYYDVNDDD KTSMDDIYVD HNNVTSNNMD VPTKMHIEMN IVNNKNEIFE      2220
     EEYPISDIWN I                                                           2231
//

If you have problems or comments...

PBIL Back to PBIL home page