(data stored in ACNUC9543 zone)

EMBL: AL844507.PE86

AL844507.PE86        Location/Qualifiers
FT   CDS             join(459312..464387,465314..466567)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0809100"
FT                   /product="erythrocyte membrane protein 1, PfEMP1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0809100"
FT                   /db_xref="GOA:Q8IAS7"
FT                   /db_xref="InterPro:IPR004258"
FT                   /db_xref="InterPro:IPR008602"
FT                   /db_xref="InterPro:IPR029210"
FT                   /db_xref="InterPro:IPR029211"
FT                   /db_xref="InterPro:IPR041480"
FT                   /db_xref="InterPro:IPR042202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAS7"
FT                   /protein_id="CAD51283.1"
FT                   /translation="MSTLGGGTDKSAKHVLDEFGQQVYEQVKNGEAKTYFDELHGDLSE
FT                   ATYPGDENPNKTTPPNPCLLQYDYNSNVTIGGGREYPCKDRPEVRFSDEYGGQCTDSKI
FT                   KGNEDNKGGACAPFRRLFLCDQHLSHMKAEKINNKHNLLLEVCLAAKYEGESLKGYHDK
FT                   YNATYSDSRSQLCTVLARSFADIGDIIRGKDLFIGYDKKDRVQKKKLQDSLKNIFGNIY
FT                   NELTTSGKNVDKAKARYNDPKGDFFQLREDWWALNREKVWSAITCNAQGNKYFRPTCSG
FT                   GESIAHNKCTCINGDPPTYFDYVPQYLRWFEEWAEDFCRKRKHKLQNAKEQCRGKNGED
FT                   KYCDLNGYDCKRTISAEKKLFPDSDCNKCSYSCIPFRTWIDNQKLEFLKQKNKYDKEKE
FT                   KNNDTTKTTRYGPINNLYAKDFYDKLKQQYITVDSFLELLNKEKECKNHPEVGDGKKTF
FT                   VDFSNKNVDETFSRTEICEPCPWCGIEKQEDGKWKRLNENAPECPQEIEKTYPESNTTD
FT                   IPVLTPEKGKTSILQKYRIFCQNAENNKQIKEWQCHYEKNDKSDDSDETHNSDNCILGK
FT                   WENFEKGQEFKSYYSFFYGSIIDMLKDSVDWRDKLNNCINNETKACKNGCNKNCDCYKR
FT                   WVEKKQQEWSNIKKHFGKQGDLLEEIKGEDPGKILEFYLKSIFLQDMKEAQGDPKAIKR
FT                   FTDLLQKKNNPGTDDTTKTIIDKFLQEELTDANRCKETHKDDCSQQEVTRLRSADPSPD
FT                   TVDSASEDEDEEDKDHQEETEDTAQDTGQGEEETATEKVAPTVVDVCATVAEALTKGDL
FT                   NAACTLKYGTPNRYWGWKCIGDKTATGEARAGRVARSPPETAPSSAKSGEPTGSICIPP
FT                   RRRRLYIQKLHEWASRGGDEATKSQSQAGGSEAQPQGGEKSPSGKVSSQSDKLRTAFIQ
FT                   SAAIETFFLWHKYKAENTKTQSVGSPLLLLPQLPRSGSDDKDPETSLKSGTIPIDFLRL
FT                   MFYTIADYKDIFEGKNMEVVNLLKDGSPSDKEMQERESKIKDAIDKVFPNSDNKKHSGV
FT                   PSQTGNTTPQTLWSKYAEPIWNGMICALTYRDSEEKGGTPTQNNTVKTELYDKNTKENG
FT                   KYNYHTVTLEDDSDETRPKIGTSPSGEKTYLSKFVLRPPYFRYLEEWGETFCRERTRRL
FT                   EKIQGDCTQGDDEYKCSGYGENCKDIREQDYSIISNFNCPDCGKSCRSYKKWINIKKDE
FT                   FTKHSNVYNEQKEKAKNNKDPESKSGNISDHEFVGKLDKDYASIDSFLEKLGSCSKNNK
FT                   DNGDGTINFKEPDVTFKPADNCKPCSEFKVNCRNGNCKGANGNTCNGETVTAEEITKMS
FT                   DSTVIDIRVSDNSENVFEDILDECQNAGIFEGIRKEQWTCGYVCGVDICEQTNVNVNQN
FT                   DKEYIQIRALLKRWVDHFLEDYIKIKHKISHCIDNGKGNICKNKCNDKCNCASKWIDEK
FT                   RTEWKTIRDRYFEQYKGAQSDVYDVKGFLEDLQSQIPVTINKAIEPCKDLGEFERSTHC
FT                   NGAASSENGKPQKKDIIECLLDKLEKKTKKCKDDHPQPSAENQAQTCENSAHVEDDDEP
FT                   LEEEGDQNPVGKQQPSFCPPVEDKKKEEEGETCTPASPAPAPAPSEDPPVPAPAGDQKE
FT                   ASTPKVAPRPKPPRVKPQQPGDDPWEPLKNAMLSSTIMWSIGIGFATFTYFYLKKKTKS
FT                   SVANLFQILQIPKGDYDIPTLKSSNRYIPYASDRYKGKTYIYMEGDSSGDEKYAFMSDT
FT                   TDVTSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKRDIPSGDIPHTNKFTDNEWNQ
FT                   LKKDFISNMLQNTQNTEPNVLHDNVDNNTHPTMSRHNVDQKPFIMSIHDRNLYIGEEYS
FT                   YDMSTNSGENNLYSGIDPTSANHDSYSGIDLINDALNGDYDIYDEILKRKENELFGTNH
FT                   TKKNTSTNSVAKNTNSDPILNQINLFHKWLDRHRNMCEQWDKNKKEEFLDKLKKEWNKE
FT                   NNNNSGDINNRYENVLNTDVSIQIDMHNPKPKNEFTNMDTNPDNFIKDTILNDLEKHRE
FT                   PYFYDIYDDDITYFDTDDVKPPMDDIHIKEQTEMNALHNNKMNELLEKEYPISDIWNI"
     MSTLGGGTDK SAKHVLDEFG QQVYEQVKNG EAKTYFDELH GDLSEATYPG DENPNKTTPP        60
     NPCLLQYDYN SNVTIGGGRE YPCKDRPEVR FSDEYGGQCT DSKIKGNEDN KGGACAPFRR       120
     LFLCDQHLSH MKAEKINNKH NLLLEVCLAA KYEGESLKGY HDKYNATYSD SRSQLCTVLA       180
     RSFADIGDII RGKDLFIGYD KKDRVQKKKL QDSLKNIFGN IYNELTTSGK NVDKAKARYN       240
     DPKGDFFQLR EDWWALNREK VWSAITCNAQ GNKYFRPTCS GGESIAHNKC TCINGDPPTY       300
     FDYVPQYLRW FEEWAEDFCR KRKHKLQNAK EQCRGKNGED KYCDLNGYDC KRTISAEKKL       360
     FPDSDCNKCS YSCIPFRTWI DNQKLEFLKQ KNKYDKEKEK NNDTTKTTRY GPINNLYAKD       420
     FYDKLKQQYI TVDSFLELLN KEKECKNHPE VGDGKKTFVD FSNKNVDETF SRTEICEPCP       480
     WCGIEKQEDG KWKRLNENAP ECPQEIEKTY PESNTTDIPV LTPEKGKTSI LQKYRIFCQN       540
     AENNKQIKEW QCHYEKNDKS DDSDETHNSD NCILGKWENF EKGQEFKSYY SFFYGSIIDM       600
     LKDSVDWRDK LNNCINNETK ACKNGCNKNC DCYKRWVEKK QQEWSNIKKH FGKQGDLLEE       660
     IKGEDPGKIL EFYLKSIFLQ DMKEAQGDPK AIKRFTDLLQ KKNNPGTDDT TKTIIDKFLQ       720
     EELTDANRCK ETHKDDCSQQ EVTRLRSADP SPDTVDSASE DEDEEDKDHQ EETEDTAQDT       780
     GQGEEETATE KVAPTVVDVC ATVAEALTKG DLNAACTLKY GTPNRYWGWK CIGDKTATGE       840
     ARAGRVARSP PETAPSSAKS GEPTGSICIP PRRRRLYIQK LHEWASRGGD EATKSQSQAG       900
     GSEAQPQGGE KSPSGKVSSQ SDKLRTAFIQ SAAIETFFLW HKYKAENTKT QSVGSPLLLL       960
     PQLPRSGSDD KDPETSLKSG TIPIDFLRLM FYTIADYKDI FEGKNMEVVN LLKDGSPSDK      1020
     EMQERESKIK DAIDKVFPNS DNKKHSGVPS QTGNTTPQTL WSKYAEPIWN GMICALTYRD      1080
     SEEKGGTPTQ NNTVKTELYD KNTKENGKYN YHTVTLEDDS DETRPKIGTS PSGEKTYLSK      1140
     FVLRPPYFRY LEEWGETFCR ERTRRLEKIQ GDCTQGDDEY KCSGYGENCK DIREQDYSII      1200
     SNFNCPDCGK SCRSYKKWIN IKKDEFTKHS NVYNEQKEKA KNNKDPESKS GNISDHEFVG      1260
     KLDKDYASID SFLEKLGSCS KNNKDNGDGT INFKEPDVTF KPADNCKPCS EFKVNCRNGN      1320
     CKGANGNTCN GETVTAEEIT KMSDSTVIDI RVSDNSENVF EDILDECQNA GIFEGIRKEQ      1380
     WTCGYVCGVD ICEQTNVNVN QNDKEYIQIR ALLKRWVDHF LEDYIKIKHK ISHCIDNGKG      1440
     NICKNKCNDK CNCASKWIDE KRTEWKTIRD RYFEQYKGAQ SDVYDVKGFL EDLQSQIPVT      1500
     INKAIEPCKD LGEFERSTHC NGAASSENGK PQKKDIIECL LDKLEKKTKK CKDDHPQPSA      1560
     ENQAQTCENS AHVEDDDEPL EEEGDQNPVG KQQPSFCPPV EDKKKEEEGE TCTPASPAPA      1620
     PAPSEDPPVP APAGDQKEAS TPKVAPRPKP PRVKPQQPGD DPWEPLKNAM LSSTIMWSIG      1680
     IGFATFTYFY LKKKTKSSVA NLFQILQIPK GDYDIPTLKS SNRYIPYASD RYKGKTYIYM      1740
     EGDSSGDEKY AFMSDTTDVT SSESEYEELD INDIYVPGSP KYKTLIEVVL EPSKRDIPSG      1800
     DIPHTNKFTD NEWNQLKKDF ISNMLQNTQN TEPNVLHDNV DNNTHPTMSR HNVDQKPFIM      1860
     SIHDRNLYIG EEYSYDMSTN SGENNLYSGI DPTSANHDSY SGIDLINDAL NGDYDIYDEI      1920
     LKRKENELFG TNHTKKNTST NSVAKNTNSD PILNQINLFH KWLDRHRNMC EQWDKNKKEE      1980
     FLDKLKKEWN KENNNNSGDI NNRYENVLNT DVSIQIDMHN PKPKNEFTNM DTNPDNFIKD      2040
     TILNDLEKHR EPYFYDIYDD DITYFDTDDV KPPMDDIHIK EQTEMNALHN NKMNELLEKE      2100
     YPISDIWNI                                                              2109
//

If you have problems or comments...

PBIL Back to PBIL home page