(data stored in ACNUC9543 zone)

EMBL: AL844507.PE87

AL844507.PE87        Location/Qualifiers
FT   CDS             complement(467943..471893)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0809200"
FT                   /product="asparagine-rich antigen Pfa55-14"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0809200"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0102:mRNA"
FT                   /db_xref="GOA:Q8IAS8"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAS8"
FT                   /protein_id="CAD51282.2"
FT                   /translation="MNNNNYYYYKKNKNTNKKTSFLESKYDKVVNNVLGLFKKNNKNKF
FT                   LSTSSALCNDVHEQILSSRLFLDLCEEKEILLYKILKKLNILNLIYFRFLKEEDIEDVH
FT                   DLHKELFPVKYHSDFYFSICNFDDNTIIDDDIIKTMEKITSSFKKNTNRRKYNSNNNKN
FT                   NNNNNNNNDNNDDNNCGNNHGCNNYSEIASSLKEGSHNTNSNNFKDINFVNNYECNNHN
FT                   NVNSYDELSTNCWNINDDEMNDIDNYYDNDEYLEETQNDILNKFNNSIDKSGIEKKKIN
FT                   KKWKEDQIFSVGVFLPFSFIDYINSDYINKLLKRKCIEKLGEKDILLDYIRFMDDCNVK
FT                   YEQNNTNDKFDKFDTSDKFDTYDKIDTSDKFDTFDKYDTCGNYYNYDSSNINDDSNSYC
FT                   HDTHINNMKSHSNSTNNSQKSTSNCTYESFKTYCNFETGDKYYKENIDYDNLKNQKRLT
FT                   NEVDAKEMSDFILSSNECSNNMNDKETQNGFDSLNEEEAFKKEDIQVNPNKNFYDCNNN
FT                   SSPTNNISHYKHYDIFNFNDKKEEHTSFNKSNNSNNNNNNLKNTTYNMINPNNVYRNVG
FT                   TLPCNIQRNNNNNNSNNNNNNNDLMYNSFSNINYDNENIYNIYKELKEKCQLYNERNSL
FT                   EEHIKNNMKYKIHLSKEMLNLYNPNERKIKRDYLIGCLSSLINYDDINNEKDYNNICDF
FT                   FKKKSNNNKKGKSYLRYMYDTSKNFLENYMPIERCFNSKNDDHIYEENFKDDKFNYDHE
FT                   YSDDNNSNNDSNDNNNNNNNNNSSNDNNCKNYYNYNYNSNSNNDAKDVLYKNHREQDEL
FT                   TYEENNFNQCIEESYTHLNNIKDNFNYSGDIKWRKQDNLFCNNILKDLSILKKNKCVKK
FT                   DARFEKILYEEIYMNKNIKAMSKKYVKKKISSIYILTVGVNEYFRGLSLASYLIEYTIY
FT                   FFYFILYKMFLYNDKFYCYIDNYTFYSFSSSLKDEYNEIFDEGVISDYSSKDMENNEEK
FT                   KDKEANSLIIYDECEKINPIKINDNIYNNKISCVDDEHITYNNNNNVNEDINATKKKKK
FT                   KKKKFYTLKYTNSSLNVWGKFKNTNSTENNDYNNDNNDFDIKRKSCSMNSNILLRYIPK
FT                   NPKGKNNYSICNSVIKECYMQIISNDYFLHLYHNIRNKHSELRRKVKHIKNINNMEIDN
FT                   NNKKSNTTTTTTTTNNNNNNNNNNNNSNNNITNKDNSSFLMANLIQPKNALFPLRINNK
FT                   ILNFFVNNFCAYNLKDKTSFNLQKVNTVKPFINNNEENYILPLYIYLHVIDYNKAAINL
FT                   YNKLNFDYVHTYENFYYINKIAFSSYLYAYFF"
     MNNNNYYYYK KNKNTNKKTS FLESKYDKVV NNVLGLFKKN NKNKFLSTSS ALCNDVHEQI        60
     LSSRLFLDLC EEKEILLYKI LKKLNILNLI YFRFLKEEDI EDVHDLHKEL FPVKYHSDFY       120
     FSICNFDDNT IIDDDIIKTM EKITSSFKKN TNRRKYNSNN NKNNNNNNNN NDNNDDNNCG       180
     NNHGCNNYSE IASSLKEGSH NTNSNNFKDI NFVNNYECNN HNNVNSYDEL STNCWNINDD       240
     EMNDIDNYYD NDEYLEETQN DILNKFNNSI DKSGIEKKKI NKKWKEDQIF SVGVFLPFSF       300
     IDYINSDYIN KLLKRKCIEK LGEKDILLDY IRFMDDCNVK YEQNNTNDKF DKFDTSDKFD       360
     TYDKIDTSDK FDTFDKYDTC GNYYNYDSSN INDDSNSYCH DTHINNMKSH SNSTNNSQKS       420
     TSNCTYESFK TYCNFETGDK YYKENIDYDN LKNQKRLTNE VDAKEMSDFI LSSNECSNNM       480
     NDKETQNGFD SLNEEEAFKK EDIQVNPNKN FYDCNNNSSP TNNISHYKHY DIFNFNDKKE       540
     EHTSFNKSNN SNNNNNNLKN TTYNMINPNN VYRNVGTLPC NIQRNNNNNN SNNNNNNNDL       600
     MYNSFSNINY DNENIYNIYK ELKEKCQLYN ERNSLEEHIK NNMKYKIHLS KEMLNLYNPN       660
     ERKIKRDYLI GCLSSLINYD DINNEKDYNN ICDFFKKKSN NNKKGKSYLR YMYDTSKNFL       720
     ENYMPIERCF NSKNDDHIYE ENFKDDKFNY DHEYSDDNNS NNDSNDNNNN NNNNNSSNDN       780
     NCKNYYNYNY NSNSNNDAKD VLYKNHREQD ELTYEENNFN QCIEESYTHL NNIKDNFNYS       840
     GDIKWRKQDN LFCNNILKDL SILKKNKCVK KDARFEKILY EEIYMNKNIK AMSKKYVKKK       900
     ISSIYILTVG VNEYFRGLSL ASYLIEYTIY FFYFILYKMF LYNDKFYCYI DNYTFYSFSS       960
     SLKDEYNEIF DEGVISDYSS KDMENNEEKK DKEANSLIIY DECEKINPIK INDNIYNNKI      1020
     SCVDDEHITY NNNNNVNEDI NATKKKKKKK KKFYTLKYTN SSLNVWGKFK NTNSTENNDY      1080
     NNDNNDFDIK RKSCSMNSNI LLRYIPKNPK GKNNYSICNS VIKECYMQII SNDYFLHLYH      1140
     NIRNKHSELR RKVKHIKNIN NMEIDNNNKK SNTTTTTTTT NNNNNNNNNN NNSNNNITNK      1200
     DNSSFLMANL IQPKNALFPL RINNKILNFF VNNFCAYNLK DKTSFNLQKV NTVKPFINNN      1260
     EENYILPLYI YLHVIDYNKA AINLYNKLNF DYVHTYENFY YINKIAFSSY LYAYFF          1316
//

If you have problems or comments...

PBIL Back to PBIL home page