(data stored in SCRATCH zone)

EMBL: AL844507.PE89

AL844507.PE89        Location/Qualifiers
FT   CDS             475573..478125
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0809400"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0809400"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0101:mRNA"
FT                   /db_xref="GOA:Q8IAS9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAS9"
FT                   /protein_id="CAD51281.1"
FT                   /translation="MRVTNKFSLISLECLQVNLLIPFYKKKTKRIDNHFFLFKRFNSFD
FT                   KIHSLDKNCNNLSFEYKNNINHIDDKNELNHNFIGKKTNFLNKQTSENKKKVLQNKNDD
FT                   KYKDFHSANENDDDKFSNNFFFCDDTHEFKNNQINEISTDNTYEYTNDEYNEDIDDDLD
FT                   TLLLTNNLNSSLIGELWHASANSIYKNNKKLDIHDEKKNKNQINHIDETSTNIIKQIDN
FT                   CVHTNINVPQTHDKQKCKENFSNSFVNEIYEKEEKETQKMKEYLEQHEEHFSTFRNSIL
FT                   CKLRIAEELSRNTNHSSKENINKYNKNKEEYYKNLIDSINNTNNPIINVNNNHYHNKKK
FT                   KKNYNYYPVNNNINYDHVETIKILDIDNIPCNILNNLFAYNIVKNCSAELCLKIISRLG
FT                   MYRDKYSQISYENMINYLGQVLNCSKNAEIIALFSRCYETISIPFLVNYVRKYGTFSRA
FT                   FIVNMYDKYFKKRLFDFVRYENNMGIRKIPNILTHPYHLSSYTKLLGECSAKKDMYVQL
FT                   KIRGHIPDTFQITEENKSEEEIDYLMNAKKDSNKKIDNVNNIDLIENSTQKNKKRSSKI
FT                   IERPKMYDIILSSEYTGLPIEHFIDKQKKIEDDKHSKDVMKTLPDKEIIIGYDILQNDF
FT                   ILNDELDKENKQKIIINKKQNGDILNVNNNNNNNKESIQSTYNMNKLNIQENQENEQNI
FT                   HFNNNENTNFILDDDCDIYVYKRFNKLNNSSFKMQTTLVKTETNEEKNQNNEIDLYINK
FT                   GQYFEEIDMEQNNKSLWKLPWNSIKKDSFYFKGRFFKIIPNEGWSEIKELSKNYIKPKR
FT                   RRTKHCIKRQRILQKKIKVNLFKKKILENYDKMKKTKK"
     MRVTNKFSLI SLECLQVNLL IPFYKKKTKR IDNHFFLFKR FNSFDKIHSL DKNCNNLSFE        60
     YKNNINHIDD KNELNHNFIG KKTNFLNKQT SENKKKVLQN KNDDKYKDFH SANENDDDKF       120
     SNNFFFCDDT HEFKNNQINE ISTDNTYEYT NDEYNEDIDD DLDTLLLTNN LNSSLIGELW       180
     HASANSIYKN NKKLDIHDEK KNKNQINHID ETSTNIIKQI DNCVHTNINV PQTHDKQKCK       240
     ENFSNSFVNE IYEKEEKETQ KMKEYLEQHE EHFSTFRNSI LCKLRIAEEL SRNTNHSSKE       300
     NINKYNKNKE EYYKNLIDSI NNTNNPIINV NNNHYHNKKK KKNYNYYPVN NNINYDHVET       360
     IKILDIDNIP CNILNNLFAY NIVKNCSAEL CLKIISRLGM YRDKYSQISY ENMINYLGQV       420
     LNCSKNAEII ALFSRCYETI SIPFLVNYVR KYGTFSRAFI VNMYDKYFKK RLFDFVRYEN       480
     NMGIRKIPNI LTHPYHLSSY TKLLGECSAK KDMYVQLKIR GHIPDTFQIT EENKSEEEID       540
     YLMNAKKDSN KKIDNVNNID LIENSTQKNK KRSSKIIERP KMYDIILSSE YTGLPIEHFI       600
     DKQKKIEDDK HSKDVMKTLP DKEIIIGYDI LQNDFILNDE LDKENKQKII INKKQNGDIL       660
     NVNNNNNNNK ESIQSTYNMN KLNIQENQEN EQNIHFNNNE NTNFILDDDC DIYVYKRFNK       720
     LNNSSFKMQT TLVKTETNEE KNQNNEIDLY INKGQYFEEI DMEQNNKSLW KLPWNSIKKD       780
     SFYFKGRFFK IIPNEGWSEI KELSKNYIKP KRRRTKHCIK RQRILQKKIK VNLFKKKILE       840
     NYDKMKKTKK                                                              850
//

If you have problems or comments...

PBIL Back to PBIL home page