(data stored in ACNUC9543 zone)

EMBL: AL844507.PE9

AL844507.PE9         Location/Qualifiers
FT   CDS             join(79823..79891,80082..80642)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0800800"
FT                   /product="Plasmodium exported protein (hyp7), unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0800800"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.161:mRNA"
FT                   /db_xref="GOA:Q8IAK7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAK7"
FT                   /protein_id="CAD51356.1"
FT                   /translation="MYFFFYKTIIYYILISISLKYNNCNIKNNPKQHDIYNVIKFRSLS
FT                   SHYSSGIKKKKKFLFKNKLTKKNVKKTEFIEGTFVIDCSGLNNLIKKTSYEKYNMEIRD
FT                   SMFKEYEKMYSELYDKEMGKKEKENLLKKFVSLLHRIPSKYIDKMLNYLMQDFLSVPIY
FT                   VIILFIIGSVTCTCACVSMVYSTIACSYALVPIFALLLYLKASESY"
     MYFFFYKTII YYILISISLK YNNCNIKNNP KQHDIYNVIK FRSLSSHYSS GIKKKKKFLF        60
     KNKLTKKNVK KTEFIEGTFV IDCSGLNNLI KKTSYEKYNM EIRDSMFKEY EKMYSELYDK       120
     EMGKKEKENL LKKFVSLLHR IPSKYIDKML NYLMQDFLSV PIYVIILFII GSVTCTCACV       180
     SMVYSTIACS YALVPIFALL LYLKASESY                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page