(data stored in SCRATCH zone)

EMBL: AL844507.PE90

AL844507.PE90        Location/Qualifiers
FT   CDS             complement(478512..478826)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0809500"
FT                   /product="histone acetyltransferase subunit NuA4, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0809500"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.114:mRNA"
FT                   /db_xref="GOA:C0H4T2"
FT                   /db_xref="InterPro:IPR015418"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4T2"
FT                   /protein_id="CAX64108.1"
FT                   /translation="MKHKVKRDIMKCKKKLESSIKALEEKILRLELEYHKNCNVNGGNL
FT                   IKGWESHLRKTPLEPLSFRTFRDDYGDSYVERMLSLTSCTSPATALFPSEDTIREKRKM
FT                   "
     MKHKVKRDIM KCKKKLESSI KALEEKILRL ELEYHKNCNV NGGNLIKGWE SHLRKTPLEP        60
     LSFRTFRDDY GDSYVERMLS LTSCTSPATA LFPSEDTIRE KRKM                        104
//

If you have problems or comments...

PBIL Back to PBIL home page