(data stored in ACNUC9543 zone)

EMBL: AL844507.PE93

AL844507.PE93        Location/Qualifiers
FT   CDS             complement(join(502338..502408,502526..502611,
FT                   502758..503021,503226..506698))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0809800"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0809800"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.112:mRNA"
FT                   /db_xref="GOA:C0H4T4"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4T4"
FT                   /protein_id="CAX64110.1"
FT                   /translation="MDVNKNESKGQNYKKKNSDIIFYTPKSNLAIDSLQKTIAFNNLFK
FT                   YVNKNIKKDEIKNDEIKNYEINNDEIKNYEINNDEIKNYEINNDEIKNYEINNDDIKSY
FT                   EINNDKIKRYEINNDKIKRYEINNDKIKRYEINNDKIKRYEINNDKIKRYEINNDKIKC
FT                   DKIKNDHLKNVPVKKKKKEYTKNMIGRKVHTDELHKENIFVLPKDNINNKFGEKKKIPL
FT                   KQKNKKVKKRTFSESTINILSYFKNDKIIKLKEKDNEKYTEKYRKTGTPHIDINNSIKS
FT                   NINSTKFNNVNIINPLITNIDNLNIVYRKVNEKSYLDVNSCHKRIRSEHYQSKIFLEEK
FT                   IKLNNIDYKNNTCNEVDDNLNHFKKYIHGNDVKQNENYLYDKNIKINDYPIHNKDEILI
FT                   EKEKYYEYLENVYLYSKKYFLSDKMEYISKYLFYKNKNLKNFIFLIDSLFLKKKYVEIL
FT                   ELLRNYRHLWIFPIHMKNKFKVKNFDKKEKINNIDTKNMTNKKHGNKQKNKNTQLFIHQ
FT                   NNIIYNDDKIINNNKKNNNNKIINNNINNNNNNNIYTDDYYNSLYKKEQNLKLFRKNIE
FT                   CEHFNRNKNIIFNNMKLYDPQNIPIQNTNDYIPKKINEKRKKKKKKNRKCSCIYVNNMC
FT                   ESYYPFIYNKKKSTKRMYYCISYIAFVKLICLLKLKNSNCLNKGIRFVSRIYKKMFLNK
FT                   NTHYFIHAIIRLYELKGLFNSSLKYSMILFLNFPLYPHIILKLFSFSILCLREEMYLIL
FT                   LASYPKHFAWFKYFLFFILYSINFQFRDKKVFDSFLFLIENVNKKKKKKKLKRKQKGKD
FT                   IIYEMEKDDFSIFDENICIDINNNKRNIENNKNNIENNKNNNENNKNNIENNKNNIENN
FT                   KNDINNINMINNNNYYYIYNLQNNICEKKEIYNNVSNDLYDLNKPMLSHDNINSNMFIY
FT                   KKIILYKSSYNKVTLYDTYNYLVNNKFSKYFPKFFIYSKLYIIINIKKSFYEKNFIMCY
FT                   SLCKLLLNDYIYDPCVITFFVNSCYLLNNVSSIKRLASDLKKNNMYIYFLFCNATLLLH
FT                   FREIDKSIQIYKYIVDTYENVFSDLYFFSFLNLINTLHITQKASQIINHCICFNKLFFN
FT                   NIQTYLLLSYHYYINNIPLKSYSSIMKAYKIYHYNPDVFYMLSLLSLTDKRYKEYVTFS
FT                   ELSLFFSLRLSIIRNYIFSKIYETQYEYLPFHLLYYNFKIVNFENSVIKFPMNMEPFMC
FT                   HLFFENLIKSYVTYHIYSSERQGLDYLLLAENLCKIGFIFFSKDLKFLQMLKFIQGYKL
FT                   KNTRMCYSIDNIS"
     MDVNKNESKG QNYKKKNSDI IFYTPKSNLA IDSLQKTIAF NNLFKYVNKN IKKDEIKNDE        60
     IKNYEINNDE IKNYEINNDE IKNYEINNDE IKNYEINNDD IKSYEINNDK IKRYEINNDK       120
     IKRYEINNDK IKRYEINNDK IKRYEINNDK IKRYEINNDK IKCDKIKNDH LKNVPVKKKK       180
     KEYTKNMIGR KVHTDELHKE NIFVLPKDNI NNKFGEKKKI PLKQKNKKVK KRTFSESTIN       240
     ILSYFKNDKI IKLKEKDNEK YTEKYRKTGT PHIDINNSIK SNINSTKFNN VNIINPLITN       300
     IDNLNIVYRK VNEKSYLDVN SCHKRIRSEH YQSKIFLEEK IKLNNIDYKN NTCNEVDDNL       360
     NHFKKYIHGN DVKQNENYLY DKNIKINDYP IHNKDEILIE KEKYYEYLEN VYLYSKKYFL       420
     SDKMEYISKY LFYKNKNLKN FIFLIDSLFL KKKYVEILEL LRNYRHLWIF PIHMKNKFKV       480
     KNFDKKEKIN NIDTKNMTNK KHGNKQKNKN TQLFIHQNNI IYNDDKIINN NKKNNNNKII       540
     NNNINNNNNN NIYTDDYYNS LYKKEQNLKL FRKNIECEHF NRNKNIIFNN MKLYDPQNIP       600
     IQNTNDYIPK KINEKRKKKK KKNRKCSCIY VNNMCESYYP FIYNKKKSTK RMYYCISYIA       660
     FVKLICLLKL KNSNCLNKGI RFVSRIYKKM FLNKNTHYFI HAIIRLYELK GLFNSSLKYS       720
     MILFLNFPLY PHIILKLFSF SILCLREEMY LILLASYPKH FAWFKYFLFF ILYSINFQFR       780
     DKKVFDSFLF LIENVNKKKK KKKLKRKQKG KDIIYEMEKD DFSIFDENIC IDINNNKRNI       840
     ENNKNNIENN KNNNENNKNN IENNKNNIEN NKNDINNINM INNNNYYYIY NLQNNICEKK       900
     EIYNNVSNDL YDLNKPMLSH DNINSNMFIY KKIILYKSSY NKVTLYDTYN YLVNNKFSKY       960
     FPKFFIYSKL YIIINIKKSF YEKNFIMCYS LCKLLLNDYI YDPCVITFFV NSCYLLNNVS      1020
     SIKRLASDLK KNNMYIYFLF CNATLLLHFR EIDKSIQIYK YIVDTYENVF SDLYFFSFLN      1080
     LINTLHITQK ASQIINHCIC FNKLFFNNIQ TYLLLSYHYY INNIPLKSYS SIMKAYKIYH      1140
     YNPDVFYMLS LLSLTDKRYK EYVTFSELSL FFSLRLSIIR NYIFSKIYET QYEYLPFHLL      1200
     YYNFKIVNFE NSVIKFPMNM EPFMCHLFFE NLIKSYVTYH IYSSERQGLD YLLLAENLCK      1260
     IGFIFFSKDL KFLQMLKFIQ GYKLKNTRMC YSIDNIS                               1297
//

If you have problems or comments...

PBIL Back to PBIL home page