(data stored in SCRATCH zone)

EMBL: AL844507.PE94

AL844507.PE94        Location/Qualifiers
FT   CDS             complement(join(508224..508574,508688..508763,
FT                   508944..509022,509155..512428))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0809900"
FT                   /product="JmjC domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0809900"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.111:mRNA"
FT                   /db_xref="GOA:Q8IAT4"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR004198"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAT4"
FT                   /protein_id="CAD51276.1"
FT                   /translation="MDKQITGIKKRKRNREFVLSCDDDDDVNYIDTGKKTNGCINKVDK
FT                   KLLNQKDLYQIKKVYDTRNKSFLKNNEINYKNIEEDNYTYIENIFDEEEFEEWKNGKKK
FT                   NDDSEQANDVFDDPIRGNINDMTNDITNDMTNDMTNDMTNDITNDMTNDITNDITNDIS
FT                   NDITNEDELIDISNNKYKKSIYKRGIDDTNMNSKKSVSMCSEYKGKCVVNNELNNIQNE
FT                   HNNVNNFERVLGNLPQRQHMSNISNGNNNNDNDNNNNNNNIINNKNNNNNINNNNNNNN
FT                   CRNNNCSNNSDDENIYKRIKEIPEINTTMEEMTNPMLFFEKYNYMGLKYGALKVIPPSF
FT                   FSPQFNSYYLNIKFNIRRQMINELKNGKEFDHPDEYWTLYEMYKYNEMLQNKYLSSDNK
FT                   FDLDNIEKTYWDIINNKKNEDVISVYGADLPVKRNQPTCIFPNKYKSNISMTKNTSNGI
FT                   IKSGTNKIKRKNTSNKINENNKNEEPINNNKKKNKKNKKHNNIYNNSVQNNIDEIVIDS
FT                   DEDEHVKSVKKIACCPKKIKENQTKASYTISKEKVLQKDTNEIIEVINILDTDNEEDHG
FT                   DNKIESHVIKSNGNNIKQNKNNTNYYNIKECDNNNNNNNMHNDKRCDHNINNTVVCKKN
FT                   DNVRKDYNFLERKNNYFCEINDIISNISENMNIKSLPFIRGSMLRNIDILIEGVNIPWL
FT                   YIGTLFSTFCWHTEDNYFASINYQHWGQPKIWYVIPPHYSDKVEDVIYEYLKENSKINI
FT                   NNNKGGTSYMGGGRRRRGKYFRKRRFSMPLHNRNNRKSSNDITNEMNVKNNSTNIDIDI
FT                   NSNSNTNNNNNNNNNNNHNYYNNRNNSLNLYNRNNNEKDYIYFEADKNNKYNFLNVNIN
FT                   DVDLIYTDPYLKYKNVDKDEIDSKKENNKNKIYKLTIQIPVEVFLKNNIPVYKNIQRKN
FT                   EFIFLWPKTFHGGFNSGYNCNEACNIAPTFWLFFGLQSYYNYKYYRNTCISIHFILFSN
FT                   LLHFHEYSFSQLKHIIYSLRYILLDEHRFFCENQSMYIDLNLQHDVLLNKKIVNYSNFV
FT                   SLDLVKIFYNFEKHKNSHFFQSVKSKLQFFYKDCDACNSPTFNSAVICPHSNDIVCIHC
FT                   YDEHACNCKYRVVLKRYTLLEMMKVLKLLIHYANKIRKSDEKEINFDDMPNYNSMKFFE
FT                   EQNSFKLFNLIRQNKKRNTPTLYADLENYCAKKLMNIEKFKRPNHNQNNNIILDDYYTS
FT                   VSHFKTKLTLKYFFLTYEEEKEENSMQILPKIVS"
     MDKQITGIKK RKRNREFVLS CDDDDDVNYI DTGKKTNGCI NKVDKKLLNQ KDLYQIKKVY        60
     DTRNKSFLKN NEINYKNIEE DNYTYIENIF DEEEFEEWKN GKKKNDDSEQ ANDVFDDPIR       120
     GNINDMTNDI TNDMTNDMTN DMTNDITNDM TNDITNDITN DISNDITNED ELIDISNNKY       180
     KKSIYKRGID DTNMNSKKSV SMCSEYKGKC VVNNELNNIQ NEHNNVNNFE RVLGNLPQRQ       240
     HMSNISNGNN NNDNDNNNNN NNIINNKNNN NNINNNNNNN NCRNNNCSNN SDDENIYKRI       300
     KEIPEINTTM EEMTNPMLFF EKYNYMGLKY GALKVIPPSF FSPQFNSYYL NIKFNIRRQM       360
     INELKNGKEF DHPDEYWTLY EMYKYNEMLQ NKYLSSDNKF DLDNIEKTYW DIINNKKNED       420
     VISVYGADLP VKRNQPTCIF PNKYKSNISM TKNTSNGIIK SGTNKIKRKN TSNKINENNK       480
     NEEPINNNKK KNKKNKKHNN IYNNSVQNNI DEIVIDSDED EHVKSVKKIA CCPKKIKENQ       540
     TKASYTISKE KVLQKDTNEI IEVINILDTD NEEDHGDNKI ESHVIKSNGN NIKQNKNNTN       600
     YYNIKECDNN NNNNNMHNDK RCDHNINNTV VCKKNDNVRK DYNFLERKNN YFCEINDIIS       660
     NISENMNIKS LPFIRGSMLR NIDILIEGVN IPWLYIGTLF STFCWHTEDN YFASINYQHW       720
     GQPKIWYVIP PHYSDKVEDV IYEYLKENSK ININNNKGGT SYMGGGRRRR GKYFRKRRFS       780
     MPLHNRNNRK SSNDITNEMN VKNNSTNIDI DINSNSNTNN NNNNNNNNNH NYYNNRNNSL       840
     NLYNRNNNEK DYIYFEADKN NKYNFLNVNI NDVDLIYTDP YLKYKNVDKD EIDSKKENNK       900
     NKIYKLTIQI PVEVFLKNNI PVYKNIQRKN EFIFLWPKTF HGGFNSGYNC NEACNIAPTF       960
     WLFFGLQSYY NYKYYRNTCI SIHFILFSNL LHFHEYSFSQ LKHIIYSLRY ILLDEHRFFC      1020
     ENQSMYIDLN LQHDVLLNKK IVNYSNFVSL DLVKIFYNFE KHKNSHFFQS VKSKLQFFYK      1080
     DCDACNSPTF NSAVICPHSN DIVCIHCYDE HACNCKYRVV LKRYTLLEMM KVLKLLIHYA      1140
     NKIRKSDEKE INFDDMPNYN SMKFFEEQNS FKLFNLIRQN KKRNTPTLYA DLENYCAKKL      1200
     MNIEKFKRPN HNQNNNIILD DYYTSVSHFK TKLTLKYFFL TYEEEKEENS MQILPKIVS       1259
//

If you have problems or comments...

PBIL Back to PBIL home page