(data stored in ACNUC9543 zone)

EMBL: AL844507.PE95

AL844507.PE95        Location/Qualifiers
FT   CDS             complement(517421..517693)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0810000"
FT                   /product="acyl-CoA binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0810000"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0099:mRNA"
FT                   /db_xref="GOA:Q8IAT5"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAT5"
FT                   /protein_id="CAD51275.1"
FT                   /translation="MRDSFNDCVQFVNKLPKTVNLSVDVKLDLYKYYKQSTVGNCNIEQ
FT                   PSMFKIEDRKKYNAWKSIENLEREEAQKRYIDIVTSLFPNWKDSE"
     MRDSFNDCVQ FVNKLPKTVN LSVDVKLDLY KYYKQSTVGN CNIEQPSMFK IEDRKKYNAW        60
     KSIENLEREE AQKRYIDIVT SLFPNWKDSE                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page