(data stored in ACNUC9543 zone)

EMBL: AL844507.PE96

AL844507.PE96        Location/Qualifiers
FT   CDS             complement(join(519331..519521,519847..519991))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0810100"
FT                   /product="apicoplast ribosomal protein L33 precursor,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0810100"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.110:mRNA"
FT                   /db_xref="GOA:C0H4T5"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4T5"
FT                   /protein_id="CAX64111.1"
FT                   /translation="MKPCDLFIYLFLYIFIIMKCYDFFIIPKNMKMVKNPIYQNRYTDN
FT                   KRNALLYAKKKRNRKVVILECTEARKLGKQPSRYVTEKNKNNTPKKLQLYKYNKYLKRR
FT                   TLHVEIK"
     MKPCDLFIYL FLYIFIIMKC YDFFIIPKNM KMVKNPIYQN RYTDNKRNAL LYAKKKRNRK        60
     VVILECTEAR KLGKQPSRYV TEKNKNNTPK KLQLYKYNKY LKRRTLHVEI K                111
//

If you have problems or comments...

PBIL Back to PBIL home page