(data stored in ACNUC9543 zone)

EMBL: AL844507.PE98

AL844507.PE98        Location/Qualifiers
FT   CDS             complement(join(525058..525186,525299..525473,
FT                   525646..526957,527568..527604))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0810300"
FT                   /product="protein phosphatase PPM5, putative"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0810300"
FT                   /db_xref="GOA:C0H4T6"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4T6"
FT                   /protein_id="CAX64112.1"
FT                   /translation="MGTCISFLKKNSVKEKKNTRRRLSISTKIDLPDDTEEIKRSIQEL
FT                   KHNEDKFKESSENVTTRRISENEVQEVVEGEENEEEEERRKKLDKKKRSLKNRSSVAGV
FT                   RASHFQEDFEKKCVKIKGSVEKLHENGIGYVCRKGLKPESPNQDDFIIITMENLALYAI
FT                   FDGHGPYGHDVSNYVQKELPYMIIKNENFLKNPKEVFTKAFLNIHENIERTTNAYLDSF
FT                   TNKNSNNKLHLNSNFVINDQALESMQGYNNYTDSDTNSDDSYDYDDTIEDDEDDEEDDE
FT                   EDESNDNKDDDHEEEEEEGESNSSIDDEFNKENKKTKKENDPDVKEEKSLTTRKKKQKK
FT                   KKMKKRKKRKNKIFFDSTMSGTTATIIVHLFKEKKLYVAYVGDSRAVLGKRKNGSKQLS
FT                   AVELTKDHKPNCAAEKKRILSSGGQVMKLEGDIPYRVFIKNKFYPGLAMSRAIGDTIGH
FT                   QIGIIAEPDFIEVNINEDEDILVLICSDGVWEFISSEEAVNLIYEFGYNNVQDAVENLA
FT                   RESWDRWLNEEENIVDDITIQAIYLSEKSKYLK"
     MGTCISFLKK NSVKEKKNTR RRLSISTKID LPDDTEEIKR SIQELKHNED KFKESSENVT        60
     TRRISENEVQ EVVEGEENEE EEERRKKLDK KKRSLKNRSS VAGVRASHFQ EDFEKKCVKI       120
     KGSVEKLHEN GIGYVCRKGL KPESPNQDDF IIITMENLAL YAIFDGHGPY GHDVSNYVQK       180
     ELPYMIIKNE NFLKNPKEVF TKAFLNIHEN IERTTNAYLD SFTNKNSNNK LHLNSNFVIN       240
     DQALESMQGY NNYTDSDTNS DDSYDYDDTI EDDEDDEEDD EEDESNDNKD DDHEEEEEEG       300
     ESNSSIDDEF NKENKKTKKE NDPDVKEEKS LTTRKKKQKK KKMKKRKKRK NKIFFDSTMS       360
     GTTATIIVHL FKEKKLYVAY VGDSRAVLGK RKNGSKQLSA VELTKDHKPN CAAEKKRILS       420
     SGGQVMKLEG DIPYRVFIKN KFYPGLAMSR AIGDTIGHQI GIIAEPDFIE VNINEDEDIL       480
     VLICSDGVWE FISSEEAVNL IYEFGYNNVQ DAVENLARES WDRWLNEEEN IVDDITIQAI       540
     YLSEKSKYLK                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page