(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4935

AL939122.SCO4935     Location/Qualifiers
FT   CDS             69..1559
FT                   /transl_table=11
FT                   /gene="SCO4935"
FT                   /gene_synonym="SCK13.27"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK13.27, possible integral membrane protein, len:
FT                   496 aa; C-terminal region similar to C-terminal region of
FT                   similar to TR:Q9UX75 (EMBL:Y18930) Sulfolobus solfataricus
FT                   hypothetical 43.0 kDa protein ORF-C10_044, 418 aa; fasta
FT                   scores: opt: 332 z-score: 303.7 E(): 2.2e-09; 27.1%
FT                   identity in 325 aa overlap. Contains 4 possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q9AD76"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AD76"
FT                   /protein_id="CAD30925.1"
FT                   /translation="MFFTYLRRELRRRRKAALVVASGLALGIALVIVVDSVSSGMGRAQ
FT                   DKVLQSLYGLGTDMTVTKAAEASSASTAERPRFRFDAQDDGSEEEQSTDRVMVQGFQTL
FT                   ASSTVGKVAGQSGVADAVGGLSLQVVKVSGEFSRGQFTQDASGGAAGGTGQGGGPGGGQ
FT                   SPQGRVQGGGADFDVNSYSVYGTDVTEPALGPLTTSTITSGRTFEESETDARVAVADSA
FT                   YAKEKKLKAGSTVTVKDTKFEIVGIATADSGDAAASLYVPLKQAQTLGDAKDEVTTIYV
FT                   KATDSQRIDGVKSAIQKNISGTTVTTSADLADTVSGSLSTASSLATGVGKWLSIVVLVA
FT                   AFLVAGLLTSSAVSRRVREFGTLKALGWRSGRVTRQVIGEAVVNGLVGGALGIALGLAG
FT                   AYAVTAVSPTLQAQLGGGAGGGGGAGGSGGGFGGGGLGGPGRQAAAKTLDIALTAPVSL
FT                   TTIALAVGLAVAGGLVAGGFGGWRASRLRPADALRRVE"
     MFFTYLRREL RRRRKAALVV ASGLALGIAL VIVVDSVSSG MGRAQDKVLQ SLYGLGTDMT        60
     VTKAAEASSA STAERPRFRF DAQDDGSEEE QSTDRVMVQG FQTLASSTVG KVAGQSGVAD       120
     AVGGLSLQVV KVSGEFSRGQ FTQDASGGAA GGTGQGGGPG GGQSPQGRVQ GGGADFDVNS       180
     YSVYGTDVTE PALGPLTTST ITSGRTFEES ETDARVAVAD SAYAKEKKLK AGSTVTVKDT       240
     KFEIVGIATA DSGDAAASLY VPLKQAQTLG DAKDEVTTIY VKATDSQRID GVKSAIQKNI       300
     SGTTVTTSAD LADTVSGSLS TASSLATGVG KWLSIVVLVA AFLVAGLLTS SAVSRRVREF       360
     GTLKALGWRS GRVTRQVIGE AVVNGLVGGA LGIALGLAGA YAVTAVSPTL QAQLGGGAGG       420
     GGGAGGSGGG FGGGGLGGPG RQAAAKTLDI ALTAPVSLTT IALAVGLAVA GGLVAGGFGG       480
     WRASRLRPAD ALRRVE                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page