(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4939

AL939122.SCO4939     Location/Qualifiers
FT   CDS             complement(3976..4758)
FT                   /transl_table=11
FT                   /gene="SCO4939"
FT                   /gene_synonym="SCK13.31c"
FT                   /product="hypothetical protein SCK31.31c"
FT                   /note="SCK13.31c, unknown, len: 260 aa"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AD74"
FT                   /protein_id="CAD30928.1"
FT                   /translation="MRVRRLGWAGLEIEAGGERMVIDYVRDLSPLFTGWKPGENVAVPG
FT                   GRASAALVTHLHRDHTDASALSEVLTQGAPVLRPAPGHGDDVDNVTTLLAERELVRHRL
FT                   AVEVVDVWSTRDLGPFRVTAVPAVDGLGDPQLNWVVEADGQRILHGGDTMFHGFWWLVA
FT                   RRFSPFDAVFLPANGAVVDAPHLQPPSPVPAALDPRQAAAAAEILDARFAVPIHYEPEQ
FT                   PDKIAGYVEVADPEAEFRAHAGRRAHVLAVGEWLDLAT"
     MRVRRLGWAG LEIEAGGERM VIDYVRDLSP LFTGWKPGEN VAVPGGRASA ALVTHLHRDH        60
     TDASALSEVL TQGAPVLRPA PGHGDDVDNV TTLLAERELV RHRLAVEVVD VWSTRDLGPF       120
     RVTAVPAVDG LGDPQLNWVV EADGQRILHG GDTMFHGFWW LVARRFSPFD AVFLPANGAV       180
     VDAPHLQPPS PVPAALDPRQ AAAAAEILDA RFAVPIHYEP EQPDKIAGYV EVADPEAEFR       240
     AHAGRRAHVL AVGEWLDLAT                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page