(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4943

AL939122.SCO4943     Location/Qualifiers
FT   CDS             6765..7757
FT                   /transl_table=11
FT                   /gene="SCO4943"
FT                   /gene_synonym="2SCK31.03"
FT                   /product="putative oxidoreductase"
FT                   /note="2SCK31.03, probable oxidoreductase, len: 330 aa;
FT                   similar to TR:AAG05923 (EMBL:AE004681) Pseudomonas
FT                   aeruginosa probable oxidoreductase PA2535, 331 aa; fasta
FT                   scores: opt: 1001 z-score: 1136.6 E(): 0; 48.2% identity in
FT                   328 aa overlap. Contains Pfam match to entry PF00248
FT                   aldo_ket_red, Aldo/keto reductase family"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWV3"
FT                   /protein_id="CAC21631.2"
FT                   /translation="MQHRTLGQQGLRVSALGLGVMGMSLAYGPSNDEDGISTIHRAHEL
FT                   GVDFFDTAELYGQGTGSNETLLGNAVNDFRDEVVLATKFGFDMTSKSLGSGVNSRPENI
FT                   REVAENSLRYLRTDRIDLFYQHISDPDVPAEEVAGTVGDLITEGKVRYFGLSNVGPRYI
FT                   RRAHAVTPVTALQYEYSIFEREVEDEILPVVRELGIGLVPYSPLGRGFLSGVVRPAGEY
FT                   PEDDMRRWDERWQGENYAYNLNAAEQLRKLAATKGITPAQLALAWLLAQGEDVVPIPGT
FT                   RSAARLEENVGAIDAELTEADLARIREVIPQGSAGSRYPASMMAGFRTD"
     MQHRTLGQQG LRVSALGLGV MGMSLAYGPS NDEDGISTIH RAHELGVDFF DTAELYGQGT        60
     GSNETLLGNA VNDFRDEVVL ATKFGFDMTS KSLGSGVNSR PENIREVAEN SLRYLRTDRI       120
     DLFYQHISDP DVPAEEVAGT VGDLITEGKV RYFGLSNVGP RYIRRAHAVT PVTALQYEYS       180
     IFEREVEDEI LPVVRELGIG LVPYSPLGRG FLSGVVRPAG EYPEDDMRRW DERWQGENYA       240
     YNLNAAEQLR KLAATKGITP AQLALAWLLA QGEDVVPIPG TRSAARLEEN VGAIDAELTE       300
     ADLARIREVI PQGSAGSRYP ASMMAGFRTD                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page