(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4944

AL939122.SCO4944     Location/Qualifiers
FT   CDS             complement(7855..8730)
FT                   /transl_table=11
FT                   /gene="SCO4944"
FT                   /gene_synonym="2SCK31.04c"
FT                   /product="putative DNA-binding protein"
FT                   /note="2SCK31.04c, possible DNA-binding protein, len: 314
FT                   aa; similar to TR:Q9RI67 (EMBL:AL109949) Streptomyces
FT                   coelicolor putative DNA-binding protein SCJ11.39c, 279 aa;
FT                   fasta scores: opt: 544 z-score: 640.7 E(): 3.8e-28; 40.2%
FT                   identity in 249 aa overlap. Contains Pfam match to entry
FT                   PF01381 HTH_3, Helix-turn-helix and possible
FT                   helix-turn-helix motif at residues 64..85 (+4.67 SD)"
FT                   /db_xref="GOA:Q9ADL0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADL0"
FT                   /protein_id="CAD30930.1"
FT                   /translation="MDGQLDRRAELSEFLRTRRARLKPEDVGLESYGRQRRVPGLRREE
FT                   LAQLAGVSVAYYTRLEQGNGQNVSAEVLDAIARALRLTDAEQAHLTHLARPKQQRRRAG
FT                   AARGKQPVRVALLQLLDSIDTVPAYVSGRRSEILAWNRMAAALFGDWGKLPAAERNWAR
FT                   LVFLNPDYRELFVDWDQKAYDMVSFLRMDAGRHPDDPRLSALVGELSVKSEEFRRLWAT
FT                   HDVKEKSYGVKRMRHPLVGDLTLSFETFRLVDDDEQAFITYHAEPGSPSADALRLLASW
FT                   GTDAAASLPA"
     MDGQLDRRAE LSEFLRTRRA RLKPEDVGLE SYGRQRRVPG LRREELAQLA GVSVAYYTRL        60
     EQGNGQNVSA EVLDAIARAL RLTDAEQAHL THLARPKQQR RRAGAARGKQ PVRVALLQLL       120
     DSIDTVPAYV SGRRSEILAW NRMAAALFGD WGKLPAAERN WARLVFLNPD YRELFVDWDQ       180
     KAYDMVSFLR MDAGRHPDDP RLSALVGELS VKSEEFRRLW ATHDVKEKSY GVKRMRHPLV       240
     GDLTLSFETF RLVDDDEQAF ITYHAEPGSP SADALRLLAS WGTDAAASLP A                291
//

If you have problems or comments...

PBIL Back to PBIL home page