(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO4945

AL939122.SCO4945     Location/Qualifiers
FT   CDS             8899..9939
FT                   /transl_table=11
FT                   /gene="SCO4945"
FT                   /gene_synonym="2SCK31.05"
FT                   /product="putative dehydrogenase"
FT                   /note="2SCK31.05, probable dehydrogenase, len: 346 aa;
FT                   highly similar to SW:ADH_MYCTU (EMBL:AL021287)
FT                   Mycobacterium bovis NADP-dependent alcohol dehydrogenase
FT                   AdhC, 346 aa; fasta scores: opt: 1508 z-score: 1698.9 E():
FT                   0; 64.5% identity in 346 aa overlap. Contains Pfam match to
FT                   entry PF00107 adh_zinc, Zinc-binding dehydrogenases and
FT                   matches to Prosite entries PS00059 Zinc-containing alcohol
FT                   dehydrogenases signature and PS00017 ATP/GTP-binding site
FT                   motif A (P-loop)"
FT                   /db_xref="GOA:Q9EWF1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF1"
FT                   /protein_id="CAD30931.1"
FT                   /translation="MTTVAAYAAPAAKAPLERTTIERREVREHDVLIDIKFAGICHSDI
FT                   HQAREGWGEAIFPMVPGHEIAGIVSEVGPGVTRFKVGDRVGVGCMVDSCRECENCKAGR
FT                   EQYCTSGNTGTYNAVGRDGEVTYGGYSEKVVVDENFVLGIPEGIALDEAAPLLCAGITT
FT                   YSPLKRWNAGPGKKVAVVGLGGLGHMAVKLAHALGAEVTVLSQSLRKKDDGLKLGADHY
FT                   YATSDPATFEELSGTFDLIVSTVSAPLDLGAYLGLLKTEGTLANVGAPEEPVSLNLFAL
FT                   LGGGKSLSGSMIGGIAETQEMLDFCAEHGIGAEIELIAASEINEAYERVLSSDVRYRFV
FT                   IDTATI"
     MTTVAAYAAP AAKAPLERTT IERREVREHD VLIDIKFAGI CHSDIHQARE GWGEAIFPMV        60
     PGHEIAGIVS EVGPGVTRFK VGDRVGVGCM VDSCRECENC KAGREQYCTS GNTGTYNAVG       120
     RDGEVTYGGY SEKVVVDENF VLGIPEGIAL DEAAPLLCAG ITTYSPLKRW NAGPGKKVAV       180
     VGLGGLGHMA VKLAHALGAE VTVLSQSLRK KDDGLKLGAD HYYATSDPAT FEELSGTFDL       240
     IVSTVSAPLD LGAYLGLLKT EGTLANVGAP EEPVSLNLFA LLGGGKSLSG SMIGGIAETQ       300
     EMLDFCAEHG IGAEIELIAA SEINEAYERV LSSDVRYRFV IDTATI                      346
//

If you have problems or comments...

PBIL Back to PBIL home page